DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and SLC25A35

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001307799.1 Gene:SLC25A35 / 399512 HGNCID:31921 Length:300 Species:Homo sapiens


Alignment Length:295 Identity:146/295 - (49%)
Similarity:183/295 - (62%) Gaps:5/295 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGL 69
            ||::.|.||.||.|||||::||||||||||||.|.|||.:.||::..|.:.|...|||.||:|||
Human     2 DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGLAALQKGL 66

  Fly    70 APALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQH 134
            ||||.|||::|.:||..|..|...|||..|:|:.|..|....||:.|..|.|..||.||:|....
Human    67 APALLYQFLMNGIRLGTYGLAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLGSPIYMVKTHLQ 131

  Fly   135 AQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKD 199
            |||...||||.|:||..|..||..|.:.:|:.|.||.||..|.|.:|.||.|:.||...|.||..
Human   132 AQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQ 196

  Fly   200 KGWITHPV---LLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWR 261
              |...|.   .|:..|.:.||..|.:|.:||||..||:||||.|.:|:||||:|::|...:..|
Human   197 --WEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQPTDAQGKGLMYRGILDALLQTAR 259

  Fly   262 TEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHL 296
            ||||.|||||....|||..|||.|:..|:::|..|
Human   260 TEGIFGMYKGIGASYFRLGPHTILSLFFWDQLRSL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 50/81 (62%)
PTZ00169 5..293 CDD:240302 144/290 (50%)
Mito_carr 101..201 CDD:278578 44/99 (44%)
Mito_carr 204..296 CDD:278578 44/94 (47%)
SLC25A35NP_001307799.1 Solcar 1 1..90 52/87 (60%)
Mito_carr 2..84 CDD:278578 50/81 (62%)
Solcar 2 100..193 41/92 (45%)
Mito_carr <119..194 CDD:278578 34/74 (46%)
Solcar 3 203..294 43/90 (48%)
Mito_carr 209..298 CDD:278578 43/86 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 107 1.000 Domainoid score I6509
eggNOG 1 0.900 - - E1_KOG0755
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 281 1.000 Inparanoid score I2895
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53880
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 1 1.000 - - FOG0001815
OrthoInspector 1 1.000 - - mtm8569
orthoMCL 1 0.900 - - OOG6_102209
Panther 1 1.100 - - O PTHR45928
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1023
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.