DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and SCaMC

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:315 Identity:66/315 - (20%)
Similarity:126/315 - (40%) Gaps:62/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLND-GLLALEKG-- 68
            |.||.|...:...|.|:|.:|..:|:|.:           |......:.|:||: |..::.:|  
  Fly   290 VAGGIAGAVSRTCTAPLDRIKVYLQVQTQ-----------RMGISECMHIMLNEGGSRSMWRGNG 343

  Fly    69 -----LAPALCYQFVLNSVRLSVYSNALELGYLQNADGS--ISFYRGMFFGALGGCTGTYFASPF 126
                 :||...::|       :.|.....|  ::..|||  :|.....:.||..|........|.
  Fly   344 INVLKIAPETAFKF-------AAYEQMKRL--IRGDDGSRQMSIVERFYAGAAAGGISQTIIYPM 399

  Fly   127 YMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFP 191
            .::|.:        :|:....::..:.||.:.||:..|:..|:|..:|::...|..:.:.:..: 
  Fly   400 EVLKTR--------LALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVY- 455

  Fly   192 KAKSLLKDKGWITH------PVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQ------------ 238
               ..||.:....|      ..|:....|.:|.||..:.:.|..::.||:..|            
  Fly   456 ---ETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKT 517

  Fly   239 --PVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFE 291
              |:.........:.:...|.||.|.||:.|:|:|..|.:.:..|..::::|.:|
  Fly   518 QIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYE 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 19/87 (22%)
PTZ00169 5..293 CDD:240302 66/315 (21%)
Mito_carr 101..201 CDD:278578 20/101 (20%)
Mito_carr 204..296 CDD:278578 24/108 (22%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 21/99 (21%)
Mito_carr 375..463 CDD:278578 18/99 (18%)
Mito_carr 470..581 CDD:278578 23/103 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.