DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and Bmcp

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:305 Identity:94/305 - (30%)
Similarity:146/305 - (47%) Gaps:31/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLA 70
            ||.||.|::.|...|.|||..|||:|:||:...:......||.:..|.::|...:||.||..|:.
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74

  Fly    71 PALCYQFVLNSVRLSVYSN----ALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKA 131
            ||:..|....:::...|..    |.|.|.|.|.|||...:..:...|..|...:..|:|..::|.
  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKV 139

  Fly   132 --QQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAK 194
              |.|.:.        |||  .::.....||:..|:.|.||...|:..|.:|.:||::..:...|
  Fly   140 RMQVHGKG--------QHK--GLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCK 194

  Fly   195 SLLKDK--GWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQ-PVDEKGRGL--------M 248
            ..|.:.  ..:.:..:.||.|.|.|    |:|::|.||:.||:.|| ||.....|:        :
  Fly   195 LQLMNAFGDHVGNHFISSFIASLGS----AIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKL 255

  Fly   249 YKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293
            |.|.:||..:..|.||:..:||||.|.:.|..|...:.|:.:|:|
  Fly   256 YSGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 28/80 (35%)
PTZ00169 5..293 CDD:240302 93/303 (31%)
Mito_carr 101..201 CDD:278578 25/103 (24%)
Mito_carr 204..296 CDD:278578 34/99 (34%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 29/86 (34%)
Mito_carr <132..199 CDD:278578 20/76 (26%)
Mito_carr 204..303 CDD:278578 34/101 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.