DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and PMP34

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:294 Identity:62/294 - (21%)
Similarity:125/294 - (42%) Gaps:24/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPAL 73
            ||..||....   |:|.|::|:||:.....|.|        .|.:.:|||.:|..:|.:||.|.|
  Fly    25 GGCIAMSTFY---PLDTVRSRLQLEEAGDVRST--------RQVIKEIVLGEGFQSLYRGLGPVL 78

  Fly    74 CYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQAV 138
            ....:.|.|....: :||:......:....|..:.:..|::.|.......:||:::..:...:.|
  Fly    79 QSLCISNFVYFYTF-HALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNV 142

  Fly   139 QSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVAS-SVQIGTFPKAK-SLLKDKG 201
            ...:......:.::::.|.::....||:|.|...:|||  .||:: ::|...:...| ::::..|
  Fly   143 AGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSL--MLVSNPALQFMMYEMLKRNIMRFTG 205

  Fly   202 WITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMY-------NQPVDEKGRGLMYKGLVDCFTKI 259
            . ....|..|..|..:.....|...|..::.|:..       ::|....|.....:..::....|
  Fly   206 G-EMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISI 269

  Fly   260 WRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293
            .:.:||.|:::|......::.....|.|:.:||:
  Fly   270 LQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 24/77 (31%)
PTZ00169 5..293 CDD:240302 61/292 (21%)
Mito_carr 101..201 CDD:278578 18/101 (18%)
Mito_carr 204..296 CDD:278578 17/97 (18%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 25/82 (30%)
Mito_carr 105..202 CDD:278578 18/98 (18%)
Mito_carr 214..303 CDD:278578 15/88 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.