DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and Shawn

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:330 Identity:72/330 - (21%)
Similarity:118/330 - (35%) Gaps:65/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TAAMGAVVFTNPIDVVKTRMQLQGE--------LAARG---------------TYVKP---YRHL 49
            |.||....|..|:||:|||:|.|.:        |...|               ...||   :...
  Fly    48 TGAMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGT 112

  Fly    50 PQAMLQIVLNDGLLALEKGLAPALCYQFVLNSVRLSVYS------NALELGYLQNAD-------G 101
            ..|.::|...:|:.:|..||:|.|........:....|.      ..:...|.:..|       .
  Fly   113 IDAFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPH 177

  Fly   102 SISFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGIS 166
            .|.|...:..|..|........||..:|:.:..:|.:         .|..|...:..:.::.|:.
  Fly   178 PIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQRM---------THAEMFGTIRQVVQSQGVL 233

  Fly   167 GFWRAALPSLNRTLVASSVQIGTFPKAKSLLKDKGWITHPVL-LSFCAGLSSGTLVAVANSPFDV 230
            |.||...|::.|.:..|    |.:......||....:..|.. .||.||..||::.|...:||||
  Fly   234 GLWRGLPPTILRDVPFS----GIYWTCYEYLKSSFGVVEPTFSFSFAAGAISGSVAATITTPFDV 294

  Fly   231 LTTR---------MYNQPVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLT 286
            :.|.         :::   |...:.:..|.:......|:|..|:..::.|..|..|:.||...:.
  Fly   295 VKTHEQIEFGEKFIFS---DNPPKQVATKSVAMRLASIYRMGGVPAIFSGLGPRLFKVAPACAIM 356

  Fly   287 FVFFE 291
            ...||
  Fly   357 ISSFE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 24/101 (24%)
PTZ00169 5..293 CDD:240302 72/330 (22%)
Mito_carr 101..201 CDD:278578 20/99 (20%)
Mito_carr 204..296 CDD:278578 25/98 (26%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/110 (23%)
Mito_carr 178..265 CDD:278578 20/99 (20%)
Mito_carr 268..371 CDD:278578 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.