DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and Tyler

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:389 Identity:83/389 - (21%)
Similarity:138/389 - (35%) Gaps:128/389 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TAAMGAVVFT---NPIDVVKTRMQLQGELAARGT-----YV------------------------ 43
            :|.:|.::.|   .|::|||||:|.|..:..|.|     ||                        
  Fly    51 SALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRDP 115

  Fly    44 ---KPYRHLPQAMLQIVLNDGLLALEKGLAPA------------LCYQFVLNSV-RLSVYSNALE 92
               :|.|....|.::||...|...|..||:|.            |.|:::.||: .:.:.|...|
  Fly   116 QNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSLSHIYLVSQKFE 180

  Fly    93 LGYLQN----ADG----------------------SISFYRGMFFGALGGCTGTYFA---SPFYM 128
            ...:::    |||                      |:.:|..|   |.|.|:.|...   :|..|
  Fly   181 ESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPM---ASGICSRTIVVTAITPIEM 242

  Fly   129 IKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKA 193
            ::.:..::.:         .:..:...|..:.|.:||.|.||...|::.|....|    ||:...
  Fly   243 VRIKMQSEYM---------TYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFS----GTYWAV 294

  Fly   194 KSLLKDKGWITHPV-LLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYK------- 250
            ...:|....:|.|. |.||..|..||.:......|||::||...    .|.|:.::|:       
  Fly   295 YEAIKRAFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQ----IELGQDVLYEEIGAGTG 355

  Fly   251 -----------------------GLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFE 291
                                   .::....:|:|.:|:.|:|.|..|...|..|...:....||
  Fly   356 AGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMISTFE 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 29/123 (24%)
PTZ00169 5..293 CDD:240302 83/389 (21%)
Mito_carr 101..201 CDD:278578 23/124 (19%)
Mito_carr 204..296 CDD:278578 27/119 (23%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 29/119 (24%)
Mito_carr 216..302 CDD:278578 22/101 (22%)
Mito_carr 306..429 CDD:278578 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.