DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and Mpcp1

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:313 Identity:67/313 - (21%)
Similarity:124/313 - (39%) Gaps:64/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGGTAAMGAV-VFTNPIDVVKTRMQLQGELAARGTYVKP--YRHLPQAMLQIVLNDGLLALEKGL 69
            |||..:.|:. ....|:|:||.|:|           |.|  |:.:.......:..:|:..|.||.
  Fly    80 LGGIISCGSTHTMVVPLDLVKCRLQ-----------VDPAKYKSVFTGFRISLAEEGVRGLAKGW 133

  Fly    70 AP--------ALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPF 126
            ||        .|| :|.|..|...||.:|:      ..:.:..:..|::..|  ..:..:||.  
  Fly   134 APTFIGYSMQGLC-KFGLYEVFKKVYGDAI------GEENAFLYRTGLYLAA--SASAEFFAD-- 187

  Fly   127 YMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFP 191
            ..:...:.|:.......||.   .::.:||..:....|::.|::..:|...|.:..:.::...|.
  Fly   188 IALAPMEAAKVKIQTTPGFA---KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFE 249

  Fly   192 KAKSLL------KDKGWIT--HPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLM 248
            :...||      |.:...|  ..::::|.||..:|...|:.:.|.|.:.::: ||   .||...:
  Fly   250 RTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL-NQ---AKGASAL 310

  Fly   249 YKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLT----FVFFEKLLHLR 297
                     .:.:..|..|::.|..|   |.....|||    |::....:.||
  Fly   311 ---------DVAKQLGWSGLWGGLVP---RIVMIGTLTAAQWFIYDAVKVFLR 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 24/89 (27%)
PTZ00169 5..293 CDD:240302 65/307 (21%)
Mito_carr 101..201 CDD:278578 17/105 (16%)
Mito_carr 204..296 CDD:278578 21/97 (22%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 26/91 (29%)
Mito_carr <188..258 CDD:278578 12/72 (17%)
Mito_carr 273..350 CDD:278578 20/92 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.