DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and CG8323

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:300 Identity:163/300 - (54%)
Similarity:222/300 - (74%) Gaps:0/300 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKSDFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLAL 65
            |..|||||||.|::||..|||||:|:|||:|||||||||||||:||:.:..|.:.:..|||:..|
  Fly     1 MATSDFVLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGL 65

  Fly    66 EKGLAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIK 130
            :|||||||.:||::||.|||:||.|:|..::.|..|.:|:..|:.:||:||..|.||:|||::||
  Fly    66 QKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIK 130

  Fly   131 AQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKS 195
            .|..:||.:.||||:||.||||.|||..||..||:.|.||.::.:|.|..:.|..||.||.|.|:
  Fly   131 TQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKA 195

  Fly   196 LLKDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIW 260
            ||.....:|.|.|.||.|||.:|::::||.:|.||:|||:|||.||.:||||:|:|.:|||.||.
  Fly   196 LLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKIL 260

  Fly   261 RTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHLRDRY 300
            |:||::|||||||..|.|.|||:||..:||::|:.:|.:|
  Fly   261 RSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTKY 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 53/82 (65%)
PTZ00169 5..293 CDD:240302 158/287 (55%)
Mito_carr 101..201 CDD:278578 49/99 (49%)
Mito_carr 204..296 CDD:278578 53/91 (58%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 53/82 (65%)
PTZ00169 5..293 CDD:240302 158/287 (55%)
Mito_carr 101..200 CDD:278578 49/98 (50%)
Mito_carr 206..301 CDD:278578 53/94 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471554
Domainoid 1 1.000 109 1.000 Domainoid score I6278
eggNOG 1 0.900 - - E1_KOG0755
Homologene 1 1.000 - - H68806
Inparanoid 1 1.050 295 1.000 Inparanoid score I2731
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 1 1.000 - - FOG0001815
OrthoInspector 1 1.000 - - mtm6610
orthoMCL 1 0.900 - - OOG6_102209
Panther 1 1.100 - - P PTHR45928
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1023
1211.800

Return to query results.
Submit another query.