DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and CG8026

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:327 Identity:79/327 - (24%)
Similarity:134/327 - (40%) Gaps:60/327 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KSDFVLGGTAAMGAVVFT---NPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLA 64
            |.:.::.|.:  |.||.|   :|:|::|.|..:..   .|...|..||.|..|...|...:|...
  Fly    22 KYEHLVAGVS--GGVVSTLILHPLDLIKIRFAVND---GRTATVPQYRGLSSAFTTIFRQEGFRG 81

  Fly    65 LEKGLAPAL--------CYQFVLNSVRLSVY--SNALELGYLQNADGSISFYRGMFFGALGGCTG 119
            |.||:.|.:        .|....|:::..:.  :..:.||...|          |...|..|...
  Fly    82 LYKGVTPNVWGSGSSWGLYFMFYNTIKTFIQGGNTTMPLGPTMN----------MLAAAESGILT 136

  Fly   120 TYFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVAS- 183
            ....:|.:::|.:...|...:.:.    ::..|:.||..||:..||.|.:|..:|.:   |..| 
  Fly   137 LLLTNPIWVVKTRLCLQCDAASSA----EYRGMIHALGQIYKEEGIRGLYRGFVPGM---LGVSH 194

  Fly   184 -SVQIGTFPKAKSLLKDKGWITHPV--------LLSFCAGLSSGTLVAVANSPFDVLTTRMYNQP 239
             ::|..|:.:.|:...:  :...|:        .|:|.|  .|..:.|.|..|:.|:..|:.   
  Fly   195 GAIQFMTYEELKNAYNE--YRKLPIDTKLATTEYLAFAA--VSKLIAAAATYPYQVVRARLQ--- 252

  Fly   240 VDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHLRDRYVFSQ 304
             |...|   |.|..||..:.||.||..|.|||......|..|...:||:.:|.:.|    ::.::
  Fly   253 -DHHHR---YNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSH----FLLAR 309

  Fly   305 RR 306
            |:
  Fly   310 RK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 23/93 (25%)
PTZ00169 5..293 CDD:240302 76/310 (25%)
Mito_carr 101..201 CDD:278578 21/101 (21%)
Mito_carr 204..296 CDD:278578 29/99 (29%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 72/297 (24%)
Mito_carr 23..115 CDD:278578 23/96 (24%)
Mito_carr 119..213 CDD:278578 24/112 (21%)
Mito_carr 220..307 CDD:278578 29/99 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.