DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and CG4995

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:285 Identity:67/285 - (23%)
Similarity:115/285 - (40%) Gaps:27/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGTAAMGAVVFTNPIDVVKTRMQLQG--ELAARGTYVKPYRHLPQAMLQIVLNDGLLALEK 67
            |||.|.......|:..:|.|.||..:|...  ....:||:        .....||..|..:.|.:
  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTF--------HCFRTIVQRDKFIGLYR 99

  Fly    68 GLAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQ 132
            |::..:....::|::...||.|...   |.|...|::.:  .|.|::.|....:..:|..:.|.:
  Fly   100 GISSPMGGIGLVNAIVFGVYGNVQR---LSNDPNSLTSH--FFAGSIAGVAQGFVCAPMELAKTR 159

  Fly   133 QHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLL 197
              .|....:..|.  |.|..:..|.:|.:|.||.|.::....::.|.:...:....:|......:
  Fly   160 --LQLSTQVDSGI--KFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV 220

  Fly   198 KDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRT 262
            :..| :.:.::...|||:||.    :|..|.||:.|.|   ..|..|....|.|.:||..|.:|.
  Fly   221 ETPG-VAYTLMAGGCAGMSSW----LACYPIDVVKTHM---QADALGANAKYNGFIDCAMKGFRN 277

  Fly   263 EGIHGMYKGFWPIYFRSAPHTTLTF 287
            ||....::|......|:.|.....|
  Fly   278 EGPQYFFRGLNSTLIRAFPMNAACF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 18/83 (22%)
PTZ00169 5..293 CDD:240302 67/285 (24%)
Mito_carr 101..201 CDD:278578 18/99 (18%)
Mito_carr 204..296 CDD:278578 25/84 (30%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 21/92 (23%)
PTZ00169 41..295 CDD:240302 65/276 (24%)
Mito_carr 128..218 CDD:278578 18/95 (19%)
Mito_carr 221..304 CDD:278578 26/90 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.