DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and CG4995

DIOPT Version :10

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:285 Identity:67/285 - (23%)
Similarity:115/285 - (40%) Gaps:27/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGTAAMGAVVFTNPIDVVKTRMQLQG--ELAARGTYVKPYRHLPQAMLQIVLNDGLLALEK 67
            |||.|.......|:..:|.|.||..:|...  ....:||:        .....||..|..:.|.:
  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTF--------HCFRTIVQRDKFIGLYR 99

  Fly    68 GLAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQ 132
            |::..:....::|::...||.|...   |.|...|::.:  .|.|::.|....:..:|..:.|.:
  Fly   100 GISSPMGGIGLVNAIVFGVYGNVQR---L
SNDPNSLTSH--FFAGSIAGVAQGFVCAPMELAKTR 159

  Fly   133 QHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLL 197
              .|....:..|.  |.|..:..|.:|.:|.||.|.::....::.|.:...:....:|......:
  Fly   160 --LQLSTQVDSGI--KFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV 220

  Fly   198 KDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRT 262
            :..| :.:.::...|||:||.    :|..|.||:.|.|   ..|..|....|.|.:||..|.:|.
  Fly   221 ETPG-VAYTLMAGGCAGMSSW----LACYPIDVVKTHM---QADALGANAKYNGFIDCAMKGFRN 277

  Fly   263 EGIHGMYKGFWPIYFRSAPHTTLTF 287
            ||....::|......|:.|.....|
  Fly   278 EGPQYFFRGLNSTLIRAFPMNAACF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:395101 18/83 (22%)
Mito_carr 101..201 CDD:395101 18/99 (18%)
Mito_carr 204..296 CDD:395101 25/84 (30%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:395101 21/92 (23%)
Mito_carr 128..218 CDD:395101 18/95 (19%)
Mito_carr 221..304 CDD:395101 26/90 (29%)

Return to query results.
Submit another query.