DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and MME1

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:295 Identity:70/295 - (23%)
Similarity:111/295 - (37%) Gaps:38/295 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKP-------YRHLPQAMLQIVLNDGLL 63
            |:.||...|..|:..:|:|.:|.|:|         |...|       |:.:.....:....:|..
  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQ---------TMPTPPPGQPPRYKGVIDCAARTFRYEGFR 73

  Fly    64 ALEKGLAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMF-FGALGGCTGTYFASPFY 127
            ...:|::..|.....:.:|..:||:....|  .|..|.....|..:| .|||.|........|..
  Fly    74 GFYRGISAPLVGVTPIYAVDFAVYAAGKRL--FQTDDHIRLTYPQIFAAGALAGVCSALVTVPTD 136

  Fly   128 MIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPK 192
            .||.....|.|.:..:    .:...:|....:||..||...::.....:.|. ..:.....|:..
  Fly   137 RIKVLLQTQTVSNGPL----LYNGTIDTAAKLYRQGGIRSLFKGTCACILRD-SPTGFYFVTYEF 196

  Fly   193 AKSLLKDK---GWI--THPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGL 252
            .:.|.:.|   |.|  |..:|....||:...||..    |||||.:|:.:.|     .|....|:
  Fly   197 LQELARKKSANGKISTTSTILSGGTAGIVFWTLAV----PFDVLKSRLQSAP-----EGTYKHGI 252

  Fly   253 VDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTF 287
            ...|..:..|||...:::|..||..|:.|.|...|
  Fly   253 RSVFRNLMATEGPKALFRGILPILLRAFPSTAAVF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 17/87 (20%)
PTZ00169 5..293 CDD:240302 70/295 (24%)
Mito_carr 101..201 CDD:278578 20/103 (19%)
Mito_carr 204..296 CDD:278578 26/84 (31%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 21/99 (21%)
Mito_carr 111..205 CDD:278578 19/98 (19%)
Mito_carr 208..297 CDD:278578 28/89 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441289
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.