DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and Ucp4C

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:289 Identity:84/289 - (29%)
Similarity:144/289 - (49%) Gaps:10/289 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGGTAAMGAVVFTNPIDVVKTRMQLQGELAAR-GTYVKPYRHLPQAMLQIVLNDGLLALEKGLAP 71
            :|...|...|.   |:||.|||||:.||.|.: |..:..:|.....|:::   :|..:|..|.:.
  Fly    45 IGANLAESCVF---PLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRV---EGFKSLYAGFSA 103

  Fly    72 ALCYQFVLNSVRLSVYSNALELGYLQNA--DGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQH 134
            .:...|:.||:|:.:|.........||.  :..:..|..:......||.....|:||.::|.:..
  Fly   104 MVTRNFIFNSLRVVLYDVFRRPFLYQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQ 168

  Fly   135 AQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKD 199
            .:. :...:|:..:..||:.|.:.|||..|:...|:...||..|..:.::..:|::..:|...|.
  Fly   169 TEG-RRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISKRTFKR 232

  Fly   200 KGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTEG 264
            ...:...:.|.|.:.:.:|...:|.::|.||:.:||.||||||.|:.|.||..:||..|:.|.||
  Fly   233 LLDLEEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYKNSLDCVRKLVREEG 297

  Fly   265 IHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293
            :..:|||..|.:||..|.:.|.::..|:|
  Fly   298 VLTLYKGLMPTWFRLGPFSVLFWLSVEQL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 24/79 (30%)
PTZ00169 5..293 CDD:240302 83/287 (29%)
Mito_carr 101..201 CDD:278578 22/99 (22%)
Mito_carr 204..296 CDD:278578 35/90 (39%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 24/80 (30%)
Mito_carr 137..232 CDD:278578 21/95 (22%)
Mito_carr 237..329 CDD:278578 35/90 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.