DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and Ant2

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:274 Identity:63/274 - (22%)
Similarity:117/274 - (42%) Gaps:19/274 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKG- 68
            ||::||.:|..|.....||:.||..:|:| |::.:....:.|:.:....::|....|..:..:| 
  Fly    21 DFMMGGVSAAIAKTAVAPIERVKLILQVQ-EVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGN 84

  Fly    69 LAPALCY--QFVLNSVRLSVYSNALELGYLQNADGSISFYR----GMFFGALGGCTGTYFASPFY 127
            ||..:.|  ...||.....||.:.    :|...|....|:|    .:..|...|.|...|..|..
  Fly    85 LANVIRYFPTQALNFAFKDVYKSV----FLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLD 145

  Fly   128 MIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPK 192
            ..:.:..|    .:..|...:...::|.|:.:.:::|..|.:|..:.|:...::..:...|.:..
  Fly   146 FARTRLAA----DVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDT 206

  Fly   193 AKSLLKDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFT 257
            .:..|.:..  :.|..:|:.......|:..:|:.|||.:..||..|...:|.. ::||....|:.
  Fly   207 CRDFLPNPK--STPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSE-MVYKNTAHCWL 268

  Fly   258 KIWRTEGIHGMYKG 271
            .|.:.|||...:||
  Fly   269 VIAKQEGIGAFFKG 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 22/84 (26%)
PTZ00169 5..293 CDD:240302 63/274 (23%)
Mito_carr 101..201 CDD:278578 17/103 (17%)
Mito_carr 204..296 CDD:278578 20/68 (29%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 63/274 (23%)
Mito_carr 17..111 CDD:278578 24/94 (26%)
Mito_carr 119..215 CDD:278578 17/99 (17%)
Mito_carr 218..307 CDD:278578 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441358
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.