DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and sesB

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_727448.1 Gene:sesB / 32007 FlyBaseID:FBgn0003360 Length:312 Species:Drosophila melanogaster


Alignment Length:272 Identity:62/272 - (22%)
Similarity:118/272 - (43%) Gaps:15/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKG- 68
            ||..||.:|..:.....||:.||..:|:| .::.:.:..|.|:.:....::|....|..:..:| 
  Fly    26 DFAAGGISAAVSKTAVAPIERVKLLLQVQ-HISKQISPDKQYKGMVDCFIRIPKEQGFSSFWRGN 89

  Fly    69 LAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYR----GMFFGALGGCTGTYFASPFYMI 129
            ||..:.| |...::..: :.:..:..:|...|.:..|:|    .:..|...|.|...|..|....
  Fly    90 LANVIRY-FPTQALNFA-FKDKYKQVFLGGVDKNTQFWRYFAGNLASGGAAGATSLCFVYPLDFA 152

  Fly   130 KAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAK 194
            :.:..|..    ..|.|.:.|.:.:.|..|::::||.|.:|....|:...::..:...|.:..|:
  Fly   153 RTRLAADT----GKGGQREFTGLGNCLTKIFKSDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTAR 213

  Fly   195 SLLKDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKI 259
            .:|.|..  ..|:.:|:.......|:..:.:.|||.:..||..|. ..|...::||..:.|:..|
  Fly   214 GMLPDPK--NTPIYISWAIAQVVTTVAGIVSYPFDTVRRRMMMQS-GRKATEVIYKNTLHCWATI 275

  Fly   260 WRTEGIHGMYKG 271
            .:.||....:||
  Fly   276 AKQEGTGAFFKG 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 20/82 (24%)
PTZ00169 5..293 CDD:240302 62/272 (23%)
Mito_carr 101..201 CDD:278578 22/103 (21%)
Mito_carr 204..296 CDD:278578 18/68 (26%)
sesBNP_727448.1 Mito_carr 19..116 CDD:278578 20/92 (22%)
PTZ00169 23..312 CDD:240302 62/272 (23%)
Mito_carr 124..220 CDD:278578 22/99 (22%)
Mito_carr 223..312 CDD:278578 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.