DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and SLC25A34

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_997231.1 Gene:SLC25A34 / 284723 HGNCID:27653 Length:304 Species:Homo sapiens


Alignment Length:296 Identity:129/296 - (43%)
Similarity:178/296 - (60%) Gaps:7/296 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGL 69
            |.|||.:|...|.|||||::|||||:||||||.|||||.:||.....::..:...|||..|:|||
Human     9 DLVLGASACCLACVFTNPLEVVKTRLQLQGELQARGTYPRPYHGFIASVAAVARADGLWGLQKGL 73

  Fly    70 APALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQH 134
            |..|.||.::|.||...||.|.:.|..|...|::      ..||:.|..|.:..||.|:||.|..
Human    74 AAGLLYQGLMNGVRFYCYSLACQAGLTQQPGGTV------VAGAVAGALGAFVGSPAYLIKTQLQ 132

  Fly   135 AQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKD 199
            ||.|.::|||.||.|.:::.||..|:|..|:.|.|:....::.|.:|.|:.|:.||..||:.::.
Human   133 AQTVAAVAVGHQHNHQTVLGALETIWRQQGLLGLWQGVGGAVPRVMVGSAAQLATFASAKAWVQK 197

  Fly   200 KGWITHPV-LLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTE 263
            :.|:.... |::...|:.|...|.|..:||||::||:||||||..|||.:|.||.||..||||.|
Human   198 QQWLPEDSWLVALAGGMISSIAVVVVMTPFDVVSTRLYNQPVDTAGRGQLYGGLTDCMVKIWRQE 262

  Fly   264 GIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHLRDR 299
            |...:|||..|.|.|..|||.|:.:|:::|..|..|
Human   263 GPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 43/81 (53%)
PTZ00169 5..293 CDD:240302 126/288 (44%)
Mito_carr 101..201 CDD:278578 35/99 (35%)
Mito_carr 204..296 CDD:278578 43/92 (47%)
SLC25A34NP_997231.1 Mito_carr 2..91 CDD:278578 43/81 (53%)
Solcar 1 4..97 46/87 (53%)
Solcar 2 101..194 36/98 (37%)
Mito_carr <119..197 CDD:278578 30/77 (39%)
Mito_carr 203..295 CDD:278578 43/91 (47%)
Solcar 3 204..295 43/90 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159926
Domainoid 1 1.000 97 1.000 Domainoid score I7248
eggNOG 1 0.900 - - E1_KOG0755
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68806
Inparanoid 1 1.050 281 1.000 Inparanoid score I2895
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53880
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 1 1.000 - - FOG0001815
OrthoInspector 1 1.000 - - mtm8569
orthoMCL 1 0.900 - - OOG6_102209
Panther 1 1.100 - - O PTHR45928
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1023
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.