DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and ucp-4

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_505414.1 Gene:ucp-4 / 179315 WormBaseID:WBGene00006729 Length:324 Species:Caenorhabditis elegans


Alignment Length:305 Identity:93/305 - (30%)
Similarity:147/305 - (48%) Gaps:33/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLA 70
            :.|..|||:.|...|.|:|:.|||:|:     ||..:.|  ..:.|....|:..:|.:||..|:|
 Worm    27 YFLSCTAALVAETVTYPLDITKTRLQI-----ARNKFTK--GGMVQVTYDIIRREGAMALWTGVA 84

  Fly    71 PALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHA 135
            ||:...::...:|:..|.....|.:.:..:.|...::.|..||..|....:.|||..::|.|...
 Worm    85 PAITRHYIYTGIRMGAYEQIRLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQM 149

  Fly   136 QAVQSIAVGFQH---KHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLL 197
            :.::.:    |.   ::|...|....:|||.|..|.|...:|:..|..:.:...|.|:...|..|
 Worm   150 EGLRRL----QKQPLRYTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGL 210

  Fly   198 KDK-----GWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLM--------- 248
            .|.     .|:||.| .|.||||::    |:.:.|.||:.|||.:|...|....:|         
 Worm   211 IDNFELKDNWLTHAV-ASACAGLAA----AIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDL 270

  Fly   249 YKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293
            |||:|||:.||.:.||...:||||.|.|.|.||.:...:|.:|::
 Worm   271 YKGVVDCYIKIIKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEI 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 25/80 (31%)
PTZ00169 5..293 CDD:240302 93/303 (31%)
Mito_carr 101..201 CDD:278578 26/107 (24%)
Mito_carr 204..296 CDD:278578 39/99 (39%)
ucp-4NP_505414.1 PTZ00169 20..317 CDD:240302 93/305 (30%)
Mito_carr 22..111 CDD:278578 27/90 (30%)
Mito_carr 115..214 CDD:278578 26/102 (25%)
Mito_carr <240..318 CDD:278578 30/76 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.