DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and slc25a34

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001135591.1 Gene:slc25a34 / 100216146 XenbaseID:XB-GENE-5994554 Length:301 Species:Xenopus tropicalis


Alignment Length:290 Identity:132/290 - (45%)
Similarity:182/290 - (62%) Gaps:7/290 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGL 69
            |||||.:|...|.|||||::|||||:||||||.:||||.:.||.:.|||:.:...|||..|:|||
 Frog     8 DFVLGASACCMACVFTNPLEVVKTRLQLQGELRSRGTYTRHYRGVLQAMVAVGQADGLRGLQKGL 72

  Fly    70 APALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQH 134
            ...|.||.::|.||..:||:|..:|..:...|:|:      .||:.|.||.:..||.|::|....
 Frog    73 TAGLLYQAMMNGVRFYLYSHAEGIGLTEQPGGNIA------AGAVAGATGAFVGSPAYLVKTHLQ 131

  Fly   135 AQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKD 199
            ||.|.:||||.||.|.|:..|...||:..||.|.||....::.|.:|.|:||:.||..||..:|.
 Frog   132 AQTVAAIAVGHQHNHQSVSSAFETIYKKQGILGLWRGVNGAVPRVMVGSAVQLATFANAKEWVKK 196

  Fly   200 KGWITHPV-LLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTE 263
            :.|..|.. |::...|:.|...||:|.:||||::||:||||||..|:|.:|:|.:||..||...|
 Frog   197 QQWFPHDSWLVALTGGMISSIGVAIAMTPFDVVSTRLYNQPVDSSGKGRLYRGFLDCILKIIHKE 261

  Fly   264 GIHGMYKGFWPIYFRSAPHTTLTFVFFEKL 293
            |:..:|||..|.|.|..|||.|:.:|:|:|
 Frog   262 GVLALYKGIVPAYIRLGPHTILSLLFWEEL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 45/81 (56%)
PTZ00169 5..293 CDD:240302 131/288 (45%)
Mito_carr 101..201 CDD:278578 40/99 (40%)
Mito_carr 204..296 CDD:278578 42/91 (46%)
slc25a34NP_001135591.1 Mito_carr 3..90 CDD:278578 45/81 (56%)
Mito_carr <118..196 CDD:278578 32/77 (42%)
Mito_carr 202..294 CDD:278578 42/90 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7192
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68806
Inparanoid 1 1.050 163 1.000 Inparanoid score I4090
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 1 1.000 - - FOG0001815
OrthoInspector 1 1.000 - - otm48081
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1023
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.