DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and SLC25A14

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001269126.1 Gene:SLC25A14 / 9016 HGNCID:10984 Length:353 Species:Homo sapiens


Alignment Length:324 Identity:98/324 - (30%)
Similarity:162/324 - (50%) Gaps:44/324 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGE-LAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGL 69
            ||.||:|::.|...|.||::.|||:|:||: :.||....: |:.:|.|...:.|.:|:|.|..|:
Human    41 FVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIK-YRGMFHALFRICKEEGVLALYSGI 104

  Fly    70 APALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQ 134
            ||||..|....:.::.|| .::::.:|...:.| :....|..|.:.||:.|..|:|..::|.::|
Human   105 APALLRQASYGTIKIGIY-QSLKRLFVERLEDE-TLLINMICGVVSGVISSTIANPTDVLKIRMQ 167

  Fly   135 AQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWR---------------------------GS 172
            ||.:.     :|   .||..:...||::.|..||||                           ||
Human   168 AQGSL-----FQ---GSMIGSFIDIYQQEGTRGLWRCLCSKAVTGCVLWLMPVIPALWEANAGGS 224

  Fly   173 LANV----SRATVASAVQIAVFGQAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTT 233
            |..|    .||.:...|::.|:...|..|..:|::....:..|.|....|...:||..|:|||.|
Human   225 LEGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRT 289

  Fly   234 RLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALR 297
            |:.||.. ..|....|:|.:|.:|.:.:.||.:.|||||||.:||..|::.:..:.:::|..|:
Human   290 RMMNQRA-IVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQ 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 30/81 (37%)
PTZ00169 5..293 CDD:240302 96/318 (30%)
Mito_carr 101..201 CDD:278578 32/130 (25%)
Mito_carr 204..296 CDD:278578 31/91 (34%)
SLC25A14NP_001269126.1 Mito_carr 37..133 CDD:278578 33/93 (35%)
PTZ00169 41..351 CDD:240302 97/321 (30%)
Mito_carr 134..254 CDD:278578 31/128 (24%)
Mito_carr 262..351 CDD:278578 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.