DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and AT5G19760

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_197477.1 Gene:AT5G19760 / 832096 AraportID:AT5G19760 Length:298 Species:Arabidopsis thaliana


Alignment Length:304 Identity:82/304 - (26%)
Similarity:132/304 - (43%) Gaps:36/304 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQL-QGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGL 69
            ||.||.:.|.|.....|:::||.|||| ||..|:             ....:.||:|:....|||
plant    18 FVNGGASGMLATCVIQPIDMIKVRIQLGQGSAAS-------------ITTNMLKNEGVGAFYKGL 69

  Fly    70 APALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQ 134
            :..|..|....:.||..:.....|....|:...:...:....|...|.:|:...||..|...::|
plant    70 SAGLLRQATYTTARLGSFKLLTAKAIESNDGKPLPLYQKALCGLTAGAIGACVGSPADLALIRMQ 134

  Fly   135 AQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKE 199
            |.  ..:.:..:..:.:...|:.:|....||..||:|....|.||...:...:|.:.|:...:::
plant   135 AD--NTLPLAQRRNYTNAFHALTRISADEGVLALWKGCGPTVVRAMALNMGMLASYDQSAEYMRD 197

  Fly   200 N-------GVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIY-YRGWLDCV 256
            |       .||....:..||:  ||.|.      |.|.|.|::.....||||:  | |.|.|||.
plant   198 NLGFGEMSTVVGASAVSGFCA--AACSL------PFDFVKTQIQKMQPDAQGK--YPYTGSLDCA 252

  Fly   257 LTILRSEGVYGLYKGFWPIY-LRSAPYSTLVLLFFDELIALREK 299
            :..|:..|....|.|| |:| :|.||:..:..:|.:::...::|
plant   253 MKTLKEGGPLKFYSGF-PVYCVRIAPHVMMTWIFLNQITKFQKK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 26/81 (32%)
PTZ00169 5..293 CDD:240302 81/296 (27%)
Mito_carr 101..201 CDD:278578 21/106 (20%)
Mito_carr 204..296 CDD:278578 30/93 (32%)
AT5G19760NP_197477.1 Mito_carr 13..87 CDD:395101 26/81 (32%)
Mito_carr 101..199 CDD:395101 20/99 (20%)
Mito_carr 210..292 CDD:395101 30/92 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.