DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and AT4G03115

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001329297.1 Gene:AT4G03115 / 828074 AraportID:AT4G03115 Length:346 Species:Arabidopsis thaliana


Alignment Length:297 Identity:84/297 - (28%)
Similarity:139/297 - (46%) Gaps:28/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFVLGGVA-AMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQK 67
            |.|.:.|:: |:..|| |:|::|:|.|:|:| .:..||    |...:...|:.:.||:|...|..
plant    68 SHFGISGISVALATGV-THPLDVVKVRLQMQ-HVGQRG----PLIGMTGIFLQLMKNEGRRSLYL 126

  Fly    68 GLAPALCFQFVINSFRLSIYTHA-VEKGWVHNNKGE-ISFAKGMFWGALGGVVGSYCASPFFLIK 130
            ||.|||....:....||.:|... |...|...:... :..|.|.|.||....:    .:|..::|
plant   127 GLTPALTRSVLYGGLRLGLYEPTKVSFDWAFGSTNVLVKIASGAFAGAFSTAL----TNPVEVVK 187

  Fly   131 TQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKS 195
            .:||           .:.:|.....:|:|..|.|:..||:|....:.||...:|.|:|.:.:||.
plant   188 VRLQ-----------MNPNAVPIAEVREIVSKEGIGALWKGVGPAMVRAAALTASQLATYDEAKR 241

  Fly   196 LLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRL-YNQGVDAQGRGIYYRGWLDCVLTI 259
            :|.:...:.....|..||.:.||...:|...|:|::.||| ..||.::...   ||....|...:
plant   242 ILVKRTSLEEGFHLHLCSSVVAGLVSTLITAPMDMIKTRLMLQQGSESTKT---YRNGFHCGYKV 303

  Fly   260 LRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIAL 296
            :|.||...||||.:.|:.|..|.:.:..:..::|.:|
plant   304 VRKEGPLALYKGGFAIFARLGPQTMITFILCEKLRSL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 28/83 (34%)
PTZ00169 5..293 CDD:240302 81/291 (28%)
Mito_carr 101..201 CDD:278578 25/100 (25%)
Mito_carr 204..296 CDD:278578 27/92 (29%)
AT4G03115NP_001329297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1023
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.