DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and PUMP1

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_190979.1 Gene:PUMP1 / 824578 AraportID:AT3G54110 Length:306 Species:Arabidopsis thaliana


Alignment Length:304 Identity:91/304 - (29%)
Similarity:146/304 - (48%) Gaps:31/304 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLA 70
            |.....||....|.|.|::..|.|:|||....|.......|:.:.....|:|:.:|:..|.||:.
plant    15 FACSAFAACVGEVCTIPLDTAKVRLQLQKSALAGDVTLPKYRGLLGTVGTIAREEGLRSLWKGVV 79

  Fly    71 PALCFQFVINSFRLSIYTHA----VEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKT 131
            |.|..|.:....|:.:|...    |.|.:|    |::..:|.:..|...|.:|...|:|..|:|.
plant    80 PGLHRQCLFGGLRIGMYEPVKNLYVGKDFV----GDVPLSKKILAGLTTGALGIMVANPTDLVKV 140

  Fly   132 QLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAK-S 195
            :|||:.  ::|.|...:::...:|...|.|:.||..||.|...||:|..:.:|.::|.:.|.| :
plant   141 RLQAEG--KLAAGAPRRYSGALNAYSTIVRQEGVRALWTGLGPNVARNAIINAAELASYDQVKET 203

  Fly   196 LLKENG----VVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCV 256
            :||..|    ||||     ..|||.||.|.....:|:|||.:|:       .|....|:|.:||.
plant   204 ILKIPGFTDNVVTH-----ILSGLGAGFFAVCIGSPVDVVKSRM-------MGDSGAYKGTIDCF 256

  Fly   257 LTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALREKY 300
            :..|:|:|....||||.|.:.|...::.::.|..::    .:||
plant   257 VKTLKSDGPMAFYKGFIPNFGRLGSWNVIMFLTLEQ----AKKY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 23/80 (29%)
PTZ00169 5..293 CDD:240302 89/295 (30%)
Mito_carr 101..201 CDD:278578 31/100 (31%)
Mito_carr 204..296 CDD:278578 28/91 (31%)
PUMP1NP_190979.1 Mito_carr 7..106 CDD:395101 25/90 (28%)
Mito_carr 110..206 CDD:395101 29/97 (30%)
Mito_carr 210..299 CDD:395101 32/103 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.