DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Slc25a11

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_077173.1 Gene:Slc25a11 / 67863 MGIID:1915113 Length:314 Species:Mus musculus


Alignment Length:298 Identity:93/298 - (31%)
Similarity:158/298 - (53%) Gaps:29/298 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLA 70
            |:.||:|.|||.||..|::::|.|:||.||    |:..:.||:.|.|..::.|.:|:.|:..||:
Mouse    25 FLFGGLAGMGATVFVQPLDLVKNRMQLSGE----GAKTREYKTSFHALTSILKTEGLKGIYTGLS 85

  Fly    71 PALCFQFVINSFRLSIYTHAVEK---------GWVHNNKGEISFAKGMFWGALGGVVGSYCASPF 126
            ..|..|....:.||.|||...|:         |::      :....||..||.|..||:  .:..
Mouse    86 AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL------LKALIGMTAGATGAFVGT--PAEV 142

  Fly   127 FLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFG 191
            .||:.....:.......||:    ::.:|:.:|.|:.||..||||.:..::||.|.:|.|:|.:.
Mouse   143 ALIRMTADGRLPADQRRGYK----NVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYS 203

  Fly   192 QAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYN-QGVDAQGRGIYYRGWLDC 255
            |:|..|.::|..:...:..||:.:.:|...:.|..|:|:|.||:.| :.:|.:..   |:..||.
Mouse   204 QSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPE---YKNGLDV 265

  Fly   256 VLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293
            :|.::|.||.:.|:|||.|.|.|..|::.|..:|.:::
Mouse   266 LLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 30/80 (38%)
PTZ00169 5..293 CDD:240302 93/296 (31%)
Mito_carr 101..201 CDD:278578 29/99 (29%)
Mito_carr 204..296 CDD:278578 28/91 (31%)
Slc25a11NP_077173.1 Solcar 1 23..108 33/86 (38%)
Mito_carr 24..102 CDD:278578 30/80 (38%)
Mito_carr 116..213 CDD:278578 30/108 (28%)
Solcar 2 117..208 29/102 (28%)
Mito_carr 215..309 CDD:278578 28/92 (30%)
Solcar 3 217..306 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.