DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and aralar1

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:302 Identity:86/302 - (28%)
Similarity:136/302 - (45%) Gaps:43/302 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVA-AMGAGVFTNPVEVIKTRIQLQ------GELAARGSHAQPYKSVFQAFVTVAKNDGIL 63
            |.||..| |:||.| ..|::::|||:|.|      ||:|        |::.:..|..|.:::|.:
  Fly   358 FTLGSFAGAVGATV-VYPIDLVKTRMQNQRAGSYIGEVA--------YRNSWDCFKKVVRHEGFM 413

  Fly    64 GLQKGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFL 128
            ||.:||.|.|.......:.:|::.....:|  :.:.||.|.....:..|...|.......:|..:
  Fly   414 GLYRGLLPQLMGVAPEKAIKLTVNDLVRDK--LTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEI 476

  Fly   129 IKTQLQAQAAKQIAVGYQHQHASMSDAIR--KIYRKNGVFGLWRGSLANVSRATVASAVQIAVFG 191
            :|.:|  |.|.:||.|         ..||  .:.|:.|:|||::|:.|.:.|....||:....:.
  Fly   477 VKIRL--QVAGEIASG---------SKIRAWSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYA 530

  Fly   192 QAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCV 256
            ..|:::.:.....||..| ..:|..||...:..:||.||:.|||  |.|...|:..|...| |..
  Fly   531 HTKAMMADKDGYNHPLTL-LAAGAIAGVPAASLVTPADVIKTRL--QVVARSGQTTYTGVW-DAT 591

  Fly   257 LTILRSEGVYGLYKGFWPIYLRSAP--------YSTLVLLFF 290
            ..|:..||....:||......||:|        |..|..||:
  Fly   592 KKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFY 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 28/87 (32%)
PTZ00169 5..293 CDD:240302 86/302 (28%)
Mito_carr 101..201 CDD:278578 25/101 (25%)
Mito_carr 204..296 CDD:278578 31/95 (33%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 29/100 (29%)
PTZ00169 358..631 CDD:240302 84/298 (28%)
Mito_carr 449..539 CDD:278578 25/100 (25%)
Mito_carr 544..633 CDD:278578 30/92 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.