DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and CG7943

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:302 Identity:62/302 - (20%)
Similarity:109/302 - (36%) Gaps:79/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGL 69
            :|..|..||......|.|:..:..|..|         |..|..|.|...    :::|:..|.:|:
  Fly    56 EFACGCGAAFVNIAVTYPIYKMIFRQML---------HGVPITSAFAQL----RHEGLGFLYRGM 107

  Fly    70 APALC----------------FQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVV 118
            .|.|.                .::::..:||:.|...|                      |..||
  Fly   108 LPPLAQKTISLSIMFGVFDGTRRYLVEDYRLNDYGAKV----------------------LAAVV 150

  Fly   119 GSYCAS---PFFLIKTQLQAQAAKQIAVGYQHQH-ASMSDAIRKIYRKNGVFGLWRGSLANVSRA 179
            .....|   ||..::|.|        |....||| ::..:|.|.:...:|...|:||......|.
  Fly   151 AGSAESILLPFERVQTLL--------ADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRN 207

  Fly   180 TVASAVQIAVFGQAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQ-GVDAQ 243
            .:::|:...:..:|...|.:...|:..|:..|.:|...|:.:|....||:|:...|.:: |..::
  Fly   208 GLSNALFFVLREEASVRLPKRKSVSTRTVQEFIAGAVIGASISTIFYPLNVIKVSLQSEMGQRSE 272

  Fly   244 GRGIYYRGWLDCV-LTILRSEGVYGLYKGFWPIYLRSAPYST 284
            |      .|..|. :.:.|...:...|:|        .|::|
  Fly   273 G------SWQACKRIYVERDRRIGNFYRG--------CPFNT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 19/97 (20%)
PTZ00169 5..293 CDD:240302 62/302 (21%)
Mito_carr 101..201 CDD:278578 22/103 (21%)
Mito_carr 204..296 CDD:278578 18/83 (22%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 17/92 (18%)
Mito_carr 141..229 CDD:278578 24/117 (21%)
Mito_carr 235..322 CDD:278578 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441329
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.