DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and mfrn

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:283 Identity:61/283 - (21%)
Similarity:114/283 - (40%) Gaps:39/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYK--SVFQAFVTVAKNDGILGLQKGLAP 71
            |.:|.:...|...|::.:|||:|         |.:.|.|  ::.....|:...:|:|...:|.:.
  Fly    21 GAIAGVLEHVVMYPLDSVKTRMQ---------SLSPPTKNMNIVSTLRTMITREGLLRPIRGASA 76

  Fly    72 ALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQAQ 136
            .:......:|...:.|....|......:...:::   :..||:..::....:||..:||.::|. 
  Fly    77 VVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNY---VISGAVATLIHDAISSPTDVIKQRMQM- 137

  Fly   137 AAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRG----SLANVSRATVASAVQIAVFGQAKSLL 197
                    |...:.|:...:|.||::.|....:|.    .:.|:...|:.....  .|.|.|..|
  Fly   138 --------YNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTY--EFFQNKMNL 192

  Fly   198 KENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRS 262
            :..   .:|.: ...:|.|||:..:...|||||:.|.|     :.|..|: .||.::....|...
  Fly   193 ERK---YNPPV-HMAAGAAAGACAAAVTTPLDVIKTLL-----NTQETGL-TRGMIEASRKIYHM 247

  Fly   263 EGVYGLYKGFWPIYLRSAPYSTL 285
            .|..|.::|.....|.|.|.:.:
  Fly   248 AGPLGFFRGTTARVLYSMPATAI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 16/79 (20%)
PTZ00169 5..293 CDD:240302 61/283 (22%)
Mito_carr 101..201 CDD:278578 20/103 (19%)
Mito_carr 204..296 CDD:278578 23/82 (28%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 17/85 (20%)
PTZ00168 17..280 CDD:185494 61/283 (22%)
Mito_carr 107..190 CDD:278578 18/96 (19%)
Mito_carr <215..282 CDD:278578 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441211
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.