DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and GC2

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:307 Identity:76/307 - (24%)
Similarity:127/307 - (41%) Gaps:40/307 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKG----- 68
            ||||.:.......|::::|||:|.| .:...|.  :.|.|:...|.....::|..|:.:|     
  Fly    27 GGVAGIIGVACVYPLDMVKTRLQNQ-TIGPNGE--RMYTSIADCFRKTIASEGYFGMYRGSAVNI 88

  Fly    69 --LAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKT 131
              :.|....:...|.|   ...|      :.::.|.|..::....|.|.|:......:|..|:|.
  Fly    89 VLITPEKAIKLTANDF---FRYH------LASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKI 144

  Fly   132 QLQ---AQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVF--- 190
            |:|   ..||...|.|.:.:..:.....:.:.|:.|:|||::|..|...|....|.|...:.   
  Fly   145 QMQDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVYFPLMAWI 209

  Fly   191 ---GQAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGW 252
               |..||    :|........|..:||.:|...:..:||.|||.|||...|...      ::|.
  Fly   210 NDQGPRKS----DGSGEAVFYWSLIAGLLSGMTSAFMVTPFDVVKTRLQADGEKK------FKGI 264

  Fly   253 LDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALREK 299
            :|||...|:.||:...:||.....:..||...:..:|:  .:.:.||
  Fly   265 MDCVNRTLKEEGISAFFKGGLCRIMVLAPLFGIAQMFY--FLGVGEK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 20/84 (24%)
PTZ00169 5..293 CDD:240302 74/299 (25%)
Mito_carr 101..201 CDD:278578 27/108 (25%)
Mito_carr 204..296 CDD:278578 25/91 (27%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 71/283 (25%)
Mito_carr 16..106 CDD:278578 20/84 (24%)
Mito_carr 123..203 CDD:278578 22/79 (28%)
Mito_carr 228..302 CDD:278578 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.