DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and GC1

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:119/277 - (42%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKG----- 68
            ||:|.:.......|::::|||:|.| ::...|.  :.|.|:|..|....|.:|..|:.:|     
  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQ-QIGPNGE--RMYNSMFDCFRKTYKAEGYFGMYRGSGVNI 89

  Fly    69 --LAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKT 131
              :.|....:...|.:    :.|.:.     ...|::.....|..|.|.|.......:|..|:|.
  Fly    90 LLITPEKAIKLTANDY----FRHKLT-----TKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKI 145

  Fly   132 QLQ-----AQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFG 191
            |:|     |.|||  ..|...:..|.:....::.:..|:|||::|..|...|....|.:...:|.
  Fly   146 QMQDAGRVAAAAK--LAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFA 208

  Fly   192 QAKSL--LKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLD 254
            ....|  .:.:|........||.:||||||..:||:.|.|||.|||  |.:........::|..|
  Fly   209 TLNDLGPRRNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRL--QAIKKADGEKEFKGISD 271

  Fly   255 CVLTILRSEGVYGLYKG 271
            |:...|:.||....:||
  Fly   272 CITKTLKHEGPTAFFKG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 20/84 (24%)
PTZ00169 5..293 CDD:240302 74/277 (27%)
Mito_carr 101..201 CDD:278578 26/106 (25%)
Mito_carr 204..296 CDD:278578 26/68 (38%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 18/88 (20%)
Mito_carr 115..213 CDD:278578 25/99 (25%)
Mito_carr 226..307 CDD:278578 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.