DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Tpc1

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_650034.1 Gene:Tpc1 / 41316 FlyBaseID:FBgn0037852 Length:332 Species:Drosophila melanogaster


Alignment Length:310 Identity:84/310 - (27%)
Similarity:146/310 - (47%) Gaps:34/310 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQ----GELAAR---GSHAQPYKSVFQAFVTVAKNDGILGLQ 66
            ||::|........|::|:|.|.|||    |:.||:   |:....|.|:.||..|:.:.:|:|...
  Fly    35 GGLSAAITRSTCQPLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFW 99

  Fly    67 KGLAPA--LCFQFVINSF----RLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASP 125
            ||..||  |...:.|..|    :||:.  |.:..::.:::...:|    ..||..|......::|
  Fly   100 KGHNPAQVLSIMYGICQFWTYEQLSLM--AKQTSYLADHQHLSNF----LCGAAAGGAAVIISTP 158

  Fly   126 FFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRG---SLANVSRATVASAVQI 187
            ..:|:|:|.||...:   ||:    :.:.|:..|.|:.|..|::||   :|..::.....:.:..
  Fly   159 LDVIRTRLIAQDTSK---GYR----NATRAVSAIVRQEGPRGMYRGLSSALLQITPLMGTNFMAY 216

  Fly   188 AVFGQ-AKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQ----GRGI 247
            .:|.. |.:.|:.:.....||......|.::|......:.|.|::..||..||.::.    |:.:
  Fly   217 RLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFESNRQTFGQTL 281

  Fly   248 YYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALR 297
            ...|..||:...:|.|||.|||||..|..|:|:..:.|....:|:|..:|
  Fly   282 QCHGVWDCLRLTVRQEGVRGLYKGVAPTLLKSSMTTALYFSIYDKLKQVR 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 30/90 (33%)
PTZ00169 5..293 CDD:240302 82/304 (27%)
Mito_carr 101..201 CDD:278578 23/103 (22%)
Mito_carr 204..296 CDD:278578 29/95 (31%)
Tpc1NP_650034.1 Mito_carr 29..123 CDD:278578 28/87 (32%)
PTZ00169 33..329 CDD:240302 83/306 (27%)
Mito_carr 153..222 CDD:278578 17/75 (23%)
Mito_carr 233..328 CDD:278578 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441269
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.