DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and CG16736

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:292 Identity:61/292 - (20%)
Similarity:125/292 - (42%) Gaps:45/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAPALCFQFVIN 80
            |.:.::|:|::  |:.:|..:.   .|::  .|:...|..:|:: |:.|...|:. |.|.:..::
  Fly    13 AQLLSHPMELV--RVNMQANVI---HHSR--LSINHMFRLMARH-GLPGFYYGIV-AACLRCTVH 68

  Fly    81 SFRLSIYTHAVEKGWVHNNKGEI-------SFAKGM--FWGALGGVVGSYCASPFFLIKTQLQAQ 136
            :  :|.||....   :.:||..:       |...|:  ||   |||:    |:||..:....||.
  Fly    69 T--MSTYTLFYN---LQDNKYVLMLQPYNTSMVLGITGFW---GGVL----ATPFAKLAVIRQAD 121

  Fly   137 AAKQIAVGYQHQ-HASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKEN 200
            ..:.   .|:.: :.:....::.:|.|.|...|:.|...|...:|..:.:...:..:..:::...
  Fly   122 LTRG---SYERRNYRNFWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWF 183

  Fly   201 GVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIY---YRGWLDCVLTILRS 262
            ..:..|.:....:....||.:::.:||:|.:.|...|:. ...||..|   ||       .|:|.
  Fly   184 HRLDEPWLSDLITMALTGSIITVIMTPVDALATLTLNES-SHYGRTSYPYLYR-------KIIRK 240

  Fly   263 EGVYGLYKGFWPIYLRSAPYSTLVLLFFDELI 294
            .|..|.:.|:.|..:...|::.|....:..|:
  Fly   241 HGYKGFFFGWKPALMALIPHTVLATFVYRFLL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 15/70 (21%)
PTZ00169 5..293 CDD:240302 60/289 (21%)
Mito_carr 101..201 CDD:278578 20/109 (18%)
Mito_carr 204..296 CDD:278578 22/94 (23%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 17/81 (21%)
Mito_carr 187..277 CDD:278578 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441307
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.