DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Dic4

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:286 Identity:71/286 - (24%)
Similarity:130/286 - (45%) Gaps:25/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAPAL 73
            ||.|:|.......|::::||.:|:|          :..:|:......:....|.||...|.:.|:
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQ----------RQKRSILGTVKRIHSLKGYLGFYDGFSAAI 80

  Fly    74 CFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQAQAA 138
            ..|....:....:|....:..:|..:    |:...:..|.:.|..||....|..||..::|....
  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRD----SYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMK 141

  Fly   139 KQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKENGVV 203
            :.......::|  :.|.:.:|.::.|...|::|....|.::::::..|||.:...|:.:::|..|
  Fly   142 EPPYKRRNYKH--VFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISV 204

  Fly   204 THPTILSFCSGLAAGSFVSLAIT-PLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYG 267
            .....|.|.:.|.. |.:|.||| |||||.|.:.|      .|...:|......:.::|. ||.|
  Fly   205 NDGLPLHFLTSLGT-SIISSAITHPLDVVRTIMMN------SRPGEFRTVFQASVHMMRF-GVMG 261

  Fly   268 LYKGFWPIYLRSAPYSTLVLLFFDEL 293
            .|:||.|..:|.||.:||:.:.:::|
  Fly   262 PYRGFVPTIVRKAPATTLLFVLYEQL 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 16/77 (21%)
PTZ00169 5..293 CDD:240302 70/284 (25%)
Mito_carr 101..201 CDD:278578 20/99 (20%)
Mito_carr 204..296 CDD:278578 31/91 (34%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 71/286 (25%)
Mito_carr 26..100 CDD:278578 17/83 (20%)
Mito_carr 104..201 CDD:278578 20/102 (20%)
Mito_carr 211..292 CDD:278578 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.