DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and SCaMC

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:260 Identity:68/260 - (26%)
Similarity:110/260 - (42%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VTVAKNDGILGLQKG-------LAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFW 111
            :|....||.|.:...       |||:.....:|..:|.|.|....|...|.::..:.....|::|
  Fly   222 LTRMDKDGSLNISFNEWRDFMLLAPSTDIHDLIKFWRHSTYLDIGEDMNVPDDFTQKEMQTGLWW 286

  Fly   112 -----GALGGVVGSYCASPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRG 171
                 |.:.|.|...|.:|...||..||.|.          |...:|:.:..:..:.|...:|||
  Fly   287 RHLVAGGIAGAVSRTCTAPLDRIKVYLQVQT----------QRMGISECMHIMLNEGGSRSMWRG 341

  Fly   172 SLANVSRATVASAVQIAVFGQAKSLLK-ENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRL 235
            :..||.:....:|.:.|.:.|.|.|:: ::|......:..|.:|.|||......|.|::|:.|||
  Fly   342 NGINVLKIAPETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRL 406

  Fly   236 YNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALREKY 300
                  |..|...|.|..|..:.|.:.|||...|:|:.|..|...||:.:.|..::   .|:.:|
  Fly   407 ------ALRRTGQYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYE---TLKRRY 462

  Fly   301  300
              Fly   463  462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 10/39 (26%)
PTZ00169 5..293 CDD:240302 66/251 (26%)
Mito_carr 101..201 CDD:278578 25/105 (24%)
Mito_carr 204..296 CDD:278578 27/91 (30%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455 6/24 (25%)
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008 4/19 (21%)
Mito_carr 285..370 CDD:278578 24/94 (26%)
Mito_carr 375..463 CDD:278578 29/97 (30%)
Mito_carr 470..581 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.