DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and slc25a27

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_956635.1 Gene:slc25a27 / 393312 ZFINID:ZDB-GENE-040426-1290 Length:315 Species:Danio rerio


Alignment Length:298 Identity:96/298 - (32%)
Similarity:147/298 - (49%) Gaps:13/298 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAA---RGS-HAQPYKSVFQAFVTVAKNDGILG 64
            |.|.|...||..|.:.|.|:::.|||:|:|||..:   .|| ..|.|:.:......:.:.:|.|.
Zfish    14 SKFTLSACAAAVAELVTFPLDLTKTRLQIQGEGRSGKNGGSVQTQKYRGMLSTAAGIVREEGPLK 78

  Fly    65 LQKGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLI 129
            |.:|:.||:....|.:..|:..|....|.....:..|.....|.:....:.|.:|.:.|||..|:
Zfish    79 LWQGVTPAIYRHIVYSGGRMLAYEQMRESVLGKSEDGIFPVWKAVIASMISGALGQFIASPTDLV 143

  Fly   130 KTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAK 194
            |.|:|.:..:::. |...:...:..|..||..:.|:.|||.|.:.||.||.:.:...:..:...|
Zfish   144 KVQMQMEGRRRLE-GKPPRVRGVYHAFTKIVAQGGIRGLWAGWVPNVQRAALVNLGDLMTYDTVK 207

  Fly   195 SLLKENGVVTHPTIL----SFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDC 255
            ..|..|..:...:|.    |.||||.|.:..    ||.|||.||:.||..|:.|||:.||...||
Zfish   208 HFLLRNTSIPDNSICHGLSSICSGLVAATMG----TPADVVKTRVMNQPRDSNGRGLLYRNSTDC 268

  Fly   256 VLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293
            ::..:|.||.:.|||||.|.:.|.||:|....|.|::|
Zfish   269 LVQSVRREGFFSLYKGFLPTWFRMAPWSLTFWLTFEQL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 27/86 (31%)
PTZ00169 5..293 CDD:240302 94/295 (32%)
Mito_carr 101..201 CDD:278578 26/99 (26%)
Mito_carr 204..296 CDD:278578 40/94 (43%)
slc25a27NP_956635.1 Mito_carr 13..112 CDD:278578 29/97 (30%)
PTZ00169 16..310 CDD:240302 95/296 (32%)
Mito_carr 118..213 CDD:278578 25/95 (26%)
Mito_carr 217..311 CDD:278578 40/94 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.