DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Bmcp

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_648501.1 Gene:Bmcp / 39322 FlyBaseID:FBgn0036199 Length:303 Species:Drosophila melanogaster


Alignment Length:311 Identity:94/311 - (30%)
Similarity:152/311 - (48%) Gaps:33/311 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLA 70
            ||.||||::.|...|.|::..|||:|:||:...:......|:.:..|||.:::.:|:..|..|:.
  Fly    10 FVYGGVASITAEFGTFPIDTTKTRLQIQGQKIDQSFSQLRYRGMTDAFVKISREEGLRALYSGIW 74

  Fly    71 PALCFQFVINSFRLSIY----THAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKT 131
            ||:..|....:.:...|    ..|.|:|.:.|..|.......:...|..|.:.|..|:|..::|.
  Fly    75 PAVLRQATYGTIKFGTYYTLKKLANERGLLINEDGSERVWSNILCAAAAGAISSAIANPTDVLKV 139

  Fly   132 QLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAK-S 195
            ::|...        :.||..:.....:||:..||.|||||......||.|.::|::.|:...| .
  Fly   140 RMQVHG--------KGQHKGLLGCFGEIYKYEGVRGLWRGVGPTAQRAVVIASVELPVYDFCKLQ 196

  Fly   196 LLKENG--VVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQG---------VDAQGRGIYY 249
            |:...|  |..| .|.||.:.|.:    ::|.||:||:.|||.||.         |.|......|
  Fly   197 LMNAFGDHVGNH-FISSFIASLGS----AIASTPIDVIRTRLMNQRPVSITMNGVVTAAATPKLY 256

  Fly   250 RGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALREKY 300
            .|.|||.:..:|:||:..|||||.|.::|..|::.:..:.:::|    :||
  Fly   257 SGSLDCAVQTIRNEGLPALYKGFIPTWVRMGPWNIIFFITYEQL----KKY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 25/80 (31%)
PTZ00169 5..293 CDD:240302 91/302 (30%)
Mito_carr 101..201 CDD:278578 26/100 (26%)
Mito_carr 204..296 CDD:278578 34/100 (34%)
BmcpNP_648501.1 Mito_carr 7..97 CDD:278578 26/86 (30%)
Mito_carr <132..199 CDD:278578 21/74 (28%)
Mito_carr 204..303 CDD:278578 35/107 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441368
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.