DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and CG7514

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:290 Identity:76/290 - (26%)
Similarity:137/290 - (47%) Gaps:23/290 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLA 70
            ::.||:|.|.......|::::|||:|:.   |..|.    |||.|...:.|.||:|||.|..||:
  Fly    16 YINGGLAGMLGTCIVQPLDLVKTRMQIS---ATTGE----YKSSFDCLLKVFKNEGILALYNGLS 73

  Fly    71 PALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQA 135
            ..|..|....:.|:..|...::......|......| .|..|.|.|..|:...:|..:...::.:
  Fly    74 AGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLA-SMGMGILAGAFGAMFGNPAEVALIRMMS 137

  Fly   136 QAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKE- 199
            .  .::....:..:..:.:|..:|.:..||..||:|.:..|.||.:.:.||:|.:.|.|:...| 
  Fly   138 D--NRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEY 200

  Fly   200 -NGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSE 263
             :|:..|     ..:.:.:|...::|..|||:..||:..|      :...|:|.:|.::.:.::|
  Fly   201 FSGLSLH-----IAAAMMSGLLTTIASMPLDMAKTRIQQQ------KTAEYKGTMDVLMKVSKNE 254

  Fly   264 GVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293
            |:..|:|||.|...|..|::....:|.::|
  Fly   255 GIASLWKGFTPYLCRLGPHTVFAFIFLEQL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 27/80 (34%)
PTZ00169 5..293 CDD:240302 75/288 (26%)
Mito_carr 101..201 CDD:278578 23/101 (23%)
Mito_carr 204..296 CDD:278578 23/90 (26%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 76/290 (26%)
Mito_carr 19..90 CDD:278578 27/77 (35%)
Mito_carr 104..201 CDD:278578 23/99 (23%)
Mito_carr 207..284 CDD:278578 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.