DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Tpc2

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:338 Identity:78/338 - (23%)
Similarity:127/338 - (37%) Gaps:89/338 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGVAAMGAGVFTNPVEVIKTRIQLQGELAA--RGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAP 71
            ||:|.......|.|::|:|.|.|:|.|...  :||   .|:.|..||.:|...:|:.|:.:|   
  Fly    16 GGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGS---KYRGVIHAFKSVYAEEGMRGMFRG--- 74

  Fly    72 ALCFQFVINSFRLSIYTHAVEKGWVHNNKGE---ISFAKGMFW---------------------- 111
                                      :|.|:   ||:|...||                      
  Fly    75 --------------------------HNSGQVLSISYALVQFWSYEQLRSMAHQFDYWRERPFLM 113

  Fly   112 ----GALGGVVGSYCASPFFLIKTQLQAQAAKQIAVGYQHQHASMS--DAIRKIYRKNGVFGLWR 170
                |.:.|.:|:..|.||.:::||:       :|.....:.:.|:  ..:||:|:..|..||.|
  Fly   114 FFICGGIAGCLGAVAAQPFDVVRTQM-------VAADPSSRRSQMNTFTGLRKVYKMEGWMGLSR 171

  Fly   171 G---SLANVSRATVASAVQIAVFGQAKSLLK--ENGVVTHPTILSFCSGLAAGSFVSLAITPLDV 230
            |   :|..|.....|:.:.......|..:.|  :.....|...| |.:|..:|....:.:.|.|:
  Fly   172 GLPFTLVQVFPLVGANFLFYKYLNAAVLMAKPPDQRQEIHGAFL-FLNGALSGVLAKMIVYPADL 235

  Fly   231 VTTRL----YNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFD 291
            :..|:    :.|.....||.......|.|:.|..|.||:.|.|||..|..|::...|.:....:|
  Fly   236 LKKRIQLMAFKQERKTFGRNPECPTILGCITTTFREEGIGGFYKGMLPTLLKAGLMSAVYFSIYD 300

  Fly   292 ELIALREKYDLHY 304
                   .:..||
  Fly   301 -------MFKRHY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 21/79 (27%)
PTZ00169 5..293 CDD:240302 76/325 (23%)
Mito_carr 101..201 CDD:278578 29/135 (21%)
Mito_carr 204..296 CDD:278578 25/95 (26%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 73/327 (22%)
Mito_carr 23..99 CDD:278578 25/107 (23%)
Mito_carr 108..194 CDD:278578 21/92 (23%)
Mito_carr 216..307 CDD:278578 25/98 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.