DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Shawn

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:343 Identity:83/343 - (24%)
Similarity:130/343 - (37%) Gaps:73/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AMGAGVFTNPVEVIKTRIQLQGEL--------------------------AARGSHAQPYKSVFQ 51
            ||....|..|::|||||:|.|.:.                          .|....|..:.....
  Fly    50 AMVTACFMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTID 114

  Fly    52 AFVTVAKNDGILGLQKGLAPAL-------CFQFV-INSFRLSI------YTHAVEKGWVHNNKGE 102
            ||:.:::.:||..|..||:|.|       ...|| ...|:...      ||...:. ..|:....
  Fly   115 AFIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKARFTDIHYKYTRRPDT-IAHDIPHP 178

  Fly   103 ISFAKGMFWGALGGVVGSYCASPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFG 167
            |.|...:..|..|.::...|.||..||:|::|:|         :..||.|...||::.:..||.|
  Fly   179 IPFLVPLLAGVSGRILAVTCVSPVELIRTKMQSQ---------RMTHAEMFGTIRQVVQSQGVLG 234

  Fly   168 LWRGSLANVSRATVASAVQIAVFGQAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVT 232
            ||||....:.|....|.:....:...||..   |||......||.:|..:||..:...||.|||.
  Fly   235 LWRGLPPTILRDVPFSGIYWTCYEYLKSSF---GVVEPTFSFSFAAGAISGSVAATITTPFDVVK 296

  Fly   233 TR---------LYNQGVDAQ--GRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLV 286
            |.         :::.....|  .:.:..|     :.:|.|..||..::.|..|...:.||...::
  Fly   297 THEQIEFGEKFIFSDNPPKQVATKSVAMR-----LASIYRMGGVPAIFSGLGPRLFKVAPACAIM 356

  Fly   287 LLFFDELIALREKYDLHY 304
            :..|:    ..:.:..||
  Fly   357 ISSFE----YGKSFFYHY 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 25/113 (22%)
PTZ00169 5..293 CDD:240302 81/330 (25%)
Mito_carr 101..201 CDD:278578 28/99 (28%)
Mito_carr 204..296 CDD:278578 22/102 (22%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/108 (23%)
Mito_carr 178..265 CDD:278578 28/98 (29%)
Mito_carr 268..371 CDD:278578 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.