DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Tyler

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_608327.2 Gene:Tyler / 3772349 FlyBaseID:FBgn0031038 Length:441 Species:Drosophila melanogaster


Alignment Length:405 Identity:90/405 - (22%)
Similarity:145/405 - (35%) Gaps:137/405 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VAAMGAGVFT----NPVEVIKTRIQLQGELAARGS------------------------------ 41
            |:|:..|:.|    .|:||:|||:|.|..:..|.:                              
  Fly    50 VSALVGGLITTFVVTPLEVVKTRVQTQHAIRQRPTVSKLCYVYHNGLMTHVCRSSDICVPKPGRD 114

  Fly    42 --HAQPYKSVFQAFVTVAKNDGILGLQKGLAPA------------LCFQFVINSFRLSIYTHAVE 92
              :.:|.:....|||.:....|..||..||:|.            |.::::.||.     :|.  
  Fly   115 PQNLRPLRGAMDAFVKIVCTSGFSGLWAGLSPTLVSALPSTIIYFLTYEYIKNSL-----SHI-- 172

  Fly    93 KGWVHNNKGEISFAKGMFWGALGG----------------------------VVGSYCA------ 123
              ::.:.|.|.|..|....||.||                            :....|:      
  Fly   173 --YLVSQKFEESGMKDQVPGADGGDPLDQATRGINVSATAPVSTASLPYYVPMASGICSRTIVVT 235

  Fly   124 --SPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQ 186
              :|..:::.::|::        |. .:|.:...:|.:.|::|:.|||||....|.|....|...
  Fly   236 AITPIEMVRIKMQSE--------YM-TYAELWRVLRSLIRQHGILGLWRGWPPTVMRDAPFSGTY 291

  Fly   187 IAVFGQAKSLLKENGVVTHPTIL-SFCSGLAAGSFVSLAITPLDVVTTR---------LYNQ--- 238
            .||:    ..:|....||.||.| ||.:|..:|:..:....|.|::||.         ||.:   
  Fly   292 WAVY----EAIKRAFSVTEPTFLFSFLTGAISGAVATFVTMPFDLITTHTQIELGQDVLYEEIGA 352

  Fly   239 GVDA-QGRGIYYR-------------GWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLF 289
            |..| .|.|...|             ..|..:..|.|.:||.|||.|..|..||..|...:::..
  Fly   353 GTGAGTGTGAGARPKTPQSAVANSRPSVLSRMRQIYRLQGVRGLYVGVMPRMLRVVPACAIMIST 417

  Fly   290 FDELIALREKYDLHY 304
            |:    ..:.:..||
  Fly   418 FE----YSKSFFFHY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 26/123 (21%)
PTZ00169 5..293 CDD:240302 88/392 (22%)
Mito_carr 101..201 CDD:278578 26/135 (19%)
Mito_carr 204..296 CDD:278578 33/118 (28%)
TylerNP_608327.2 Mito_carr 41..171 CDD:278578 26/125 (21%)
Mito_carr 216..302 CDD:278578 19/98 (19%)
Mito_carr 306..429 CDD:278578 34/127 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.