DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Mpcp1

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:288 Identity:68/288 - (23%)
Similarity:115/288 - (39%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGGVAAMGA-GVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAP 71
            |||:.:.|: .....|::::|.|:|:.         ...|||||..|......:|:.||.||.||
  Fly    80 LGGIISCGSTHTMVVPLDLVKCRLQVD---------PAKYKSVFTGFRISLAEEGVRGLAKGWAP 135

  Fly    72 --------ALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFL 128
                    .|| :|.:......:|..|:         ||    :..|....|..:.:..::.||.
  Fly   136 TFIGYSMQGLC-KFGLYEVFKKVYGDAI---------GE----ENAFLYRTGLYLAASASAEFFA 186

  Fly   129 IKTQLQAQAAK---QIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVF 190
            .......:|||   |...|:.   .::.:|:.|:..:.||...::|.:....|....:.::.|.|
  Fly   187 DIALAPMEAAKVKIQTTPGFA---KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACF 248

  Fly   191 GQAKSLLKENGVVTHP---------TILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRG 246
            .:...||.:. ||..|         .:::|.:|..||.|.::...|.|.|.::| ||...|.   
  Fly   249 ERTLELLYKY-VVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKL-NQAKGAS--- 308

  Fly   247 IYYRGWLDCVLTILRSEGVYGLYKGFWP 274
                     .|.:.:..|..||:.|..|
  Fly   309 ---------ALDVAKQLGWSGLWGGLVP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 24/87 (28%)
PTZ00169 5..293 CDD:240302 68/288 (24%)
Mito_carr 101..201 CDD:278578 21/102 (21%)
Mito_carr 204..296 CDD:278578 19/80 (24%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 25/89 (28%)
Mito_carr <188..258 CDD:278578 15/72 (21%)
Mito_carr 273..350 CDD:278578 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.