DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and CG8026

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:319 Identity:79/319 - (24%)
Similarity:131/319 - (41%) Gaps:59/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VAAMGAGVFT----NPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAP 71
            ||.:..||.:    :|:::||.|..:..   .|.:....|:.:..||.|:.:.:|..||.||:.|
  Fly    27 VAGVSGGVVSTLILHPLDLIKIRFAVND---GRTATVPQYRGLSSAFTTIFRQEGFRGLYKGVTP 88

  Fly    72 ---------ALCFQF--VINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASP 125
                     .|.|.|  .|.:|        ::.|   |....:.....|...|..|::.....:|
  Fly    89 NVWGSGSSWGLYFMFYNTIKTF--------IQGG---NTTMPLGPTMNMLAAAESGILTLLLTNP 142

  Fly   126 FFLIKTQ--LQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRG---SLANVSRATVASAV 185
            .:::||:  ||..||...      ::..|..|:.:||::.|:.||:||   .:..||.    .|:
  Fly   143 IWVVKTRLCLQCDAASSA------EYRGMIHALGQIYKEEGIRGLYRGFVPGMLGVSH----GAI 197

  Fly   186 QIAVFGQAKSLLKENGVVTHPTILS---FCSGLAAGSFVSLAIT-PLDVVTTRLYNQGVDAQGRG 246
            |...:.:.|:...|...:...|.|:   :.:..|....::.|.| |..||..||       |...
  Fly   198 QFMTYEELKNAYNEYRKLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARL-------QDHH 255

  Fly   247 IYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDE----LIALREKYD 301
            ..|.|..||:....|.||..|.|||......|..|...:..|.::.    |:|.|::.:
  Fly   256 HRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFLLARRKRIE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 24/90 (27%)
PTZ00169 5..293 CDD:240302 76/309 (25%)
Mito_carr 101..201 CDD:278578 25/104 (24%)
Mito_carr 204..296 CDD:278578 26/99 (26%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 73/290 (25%)
Mito_carr 23..115 CDD:278578 25/101 (25%)
Mito_carr 119..213 CDD:278578 25/103 (24%)
Mito_carr 220..307 CDD:278578 24/93 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.