DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Dic3

DIOPT Version :10

Sequence 1:NP_610934.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:213 Identity:42/213 - (19%)
Similarity:67/213 - (31%) Gaps:77/213 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 HMQSIGLTVEEVASVYLTLLFTSCLSPPLTGYLIDRFGRYKPVLLTSIVLNAVSHHLIH-----F 101
            |:.::|..:        .::.:.|      |..:||........|..|::...||..::     .
  Fly   208 HLTTLGCDI--------IVVLSHC------GIDVDRSIAANVGPLVDIIVGGHSHSFLYTGDHPT 258

  Fly   102 IP---------------ARNVIVTYRSWNVSLAGDGAALLLHGTYCPLQGYLNSSCSSNSSTSLP 151
            ||               ...|::...|....|.||   ::|   |...||.: .....|     |
  Fly   259 IPMNPVSEYPTVVSQPNGHRVLIVQASAYTKLVGD---IVL---YFDEQGVI-QRWEGN-----P 311

  Fly   152 TYLS---ASDISCADLLIP-----------------------DCALPALSAGTL---SLLEPIPP 187
            .|||   ..|.:.|..|:|                       .|.....:.|:|   |::....|
  Fly   312 IYLSNDIVPDPAVAQALVPWKVAVDEIGNRKIGATGVDLQKATCGFGECNLGSLIADSMVAAFVP 376

  Fly   188 ASEYDATFWTYLAVRFVA 205
            .:|...  |||.||..:|
  Fly   377 KAEPGQ--WTYAAVAVLA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_610934.1 PTZ00169 5..293 CDD:240302 42/213 (20%)
Dic3NP_610344.2 Mito_carr 15..91 CDD:395101
Mito_carr 93..187 CDD:395101
Mito_carr 200..281 CDD:395101 13/86 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.