DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and CG4995

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:280 Identity:69/280 - (24%)
Similarity:124/280 - (44%) Gaps:29/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFV---LGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQ 66
            |||   |||.|.:..|   :|.:.:|..:|.......:      ||..|..|.|:.:.|..:||.
  Fly    43 DFVAGLLGGAAGVLVG---HPFDTVKVHLQTDDPRNPK------YKGTFHCFRTIVQRDKFIGLY 98

  Fly    67 KGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKT 131
            :|::..:....::|:....:|.: |::  :.|:..  |.....|.|::.||...:..:|..|.||
  Fly    99 RGISSPMGGIGLVNAIVFGVYGN-VQR--LSNDPN--SLTSHFFAGSIAGVAQGFVCAPMELAKT 158

  Fly   132 QLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSL 196
            :|  |.:.|:..|.  :.......::.|.:..|:.|.::|..|.:.|.....|.....|......
  Fly   159 RL--QLSTQVDSGI--KFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQ 219

  Fly   197 LKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILR 261
            ::..| |.:..:...|:|:::.    ||..|:|||.|.:.   .||.|....|.|::||.:...|
  Fly   220 VETPG-VAYTLMAGGCAGMSSW----LACYPIDVVKTHMQ---ADALGANAKYNGFIDCAMKGFR 276

  Fly   262 SEGVYGLYKGFWPIYLRSAP 281
            :||....::|.....:|:.|
  Fly   277 NEGPQYFFRGLNSTLIRAFP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 21/84 (25%)
PTZ00169 5..293 CDD:240302 69/280 (25%)
Mito_carr 101..201 CDD:278578 21/99 (21%)
Mito_carr 204..296 CDD:278578 22/78 (28%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 23/93 (25%)
PTZ00169 41..295 CDD:240302 68/277 (25%)
Mito_carr 128..218 CDD:278578 21/95 (22%)
Mito_carr 221..304 CDD:278578 24/84 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.