DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and CG9582

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:327 Identity:72/327 - (22%)
Similarity:131/327 - (40%) Gaps:81/327 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATSDFVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQP------YKSVFQAFVTVAKN 59
            :|...|:.||::.....:..:|::|:|||:|:||        |.|      |.....|.|.:.:.
  Fly    12 LAHWQFLAGGLSGFIEIICFHPLDVVKTRMQIQG--------AHPFGGEVVYTCPLDAIVKIYRY 68

  Fly    60 DGILGLQKGLAPALCFQFVINSFRLSIY-----------------THAVEKGWVHNNKGEISFAK 107
            :|:..|.||:.|.:|.:......:..:|                 |||:.               
  Fly    69 EGLSSLWKGIVPPICVETPKRGGKFLMYESLKPYFQFGAPQPTPLTHAMS--------------- 118

  Fly   108 GMFWGALGGVVGSYCASPFFLIKTQLQAQAAKQI----AVGYQHQHASMSDAIRKIYRKNGVFGL 168
                |::..::.|:..:||.::|...||...|::    .|.|..:|...           |:.||
  Fly   119 ----GSMAAILESFLVNPFEVVKITQQAHRGKRLKTLSVVKYIIKHDGY-----------GIKGL 168

  Fly   169 WRGSLANVSRATVASAVQIAVFGQAKSLLKENGVVTHPTILSF-------CSGLAAGSFVSLAIT 226
            :||..|.|:|..|   .....||...:|   ..:|..|...::       .:|||:.....:::|
  Fly   169 YRGITALVARNAV---FHFGFFGFYNAL---KDIVPSPEDKTYNILRKVIIAGLASSLACVMSVT 227

  Fly   227 PLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFD 291
             ||:...|:  ||.......:.|:..:..:.:..:.||...|:||...:.||..|...::|:.::
  Fly   228 -LDMAKCRI--QGPQPVKGEVKYQWTISTIKSTFKEEGFRSLFKGLGAMILRVGPGGAMLLVTYE 289

  Fly   292 EL 293
            .|
  Fly   290 YL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 22/88 (25%)
PTZ00169 5..293 CDD:240302 70/321 (22%)
Mito_carr 101..201 CDD:278578 23/103 (22%)
Mito_carr 204..296 CDD:278578 21/97 (22%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 71/322 (22%)
Mito_carr 17..104 CDD:278578 23/94 (24%)
Mito_carr 109..196 CDD:278578 26/122 (21%)
Mito_carr 216..295 CDD:278578 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441360
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.