DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and MME1

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:294 Identity:78/294 - (26%)
Similarity:129/294 - (43%) Gaps:25/294 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQP--YKSVFQAFVTVAKNDGILGLQKG 68
            |:.|||..|...:..:|::.||.|:|..    ......||  ||.|........:.:|..|..:|
  Fly    18 FIAGGVGGMCNVLVGHPLDTIKVRLQTM----PTPPPGQPPRYKGVIDCAARTFRYEGFRGFYRG 78

  Fly    69 LAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQL 133
            ::..|.....|.:...::|. |.::.:..::...:::.:....|||.||..:....|...||..|
  Fly    79 ISAPLVGVTPIYAVDFAVYA-AGKRLFQTDDHIRLTYPQIFAAGALAGVCSALVTVPTDRIKVLL 142

  Fly   134 QAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLK 198
            |.|......:.|.    ...|...|:||:.|:..|::|:.|.:.|.: .:......:...:.|.:
  Fly   143 QTQTVSNGPLLYN----GTIDTAAKLYRQGGIRSLFKGTCACILRDS-PTGFYFVTYEFLQELAR 202

  Fly   199 E---NG-VVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTI 259
            :   || :.|..||||  .|.|...|.:||: |.||:.:||     .:...|.|..|.......:
  Fly   203 KKSANGKISTTSTILS--GGTAGIVFWTLAV-PFDVLKSRL-----QSAPEGTYKHGIRSVFRNL 259

  Fly   260 LRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293
            :.:||...|::|..||.||:.| ||..:.|..||
  Fly   260 MATEGPKALFRGILPILLRAFP-STAAVFFGVEL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 20/82 (24%)
PTZ00169 5..293 CDD:240302 76/292 (26%)
Mito_carr 101..201 CDD:278578 22/102 (22%)
Mito_carr 204..296 CDD:278578 32/90 (36%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 22/93 (24%)
Mito_carr 111..205 CDD:278578 22/98 (22%)
Mito_carr 208..297 CDD:278578 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.