DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Ucp4B

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:289 Identity:86/289 - (29%)
Similarity:153/289 - (52%) Gaps:5/289 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLAPALCFQ 76
            :|..|.:...|.::.|||:|:|||:|:|......|:.:....:.:.:.:|:|.|..|::..|...
  Fly    46 SACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMGIVREEGLLKLYGGISAMLFRH 110

  Fly    77 FVINSFRLSIYTHAVEKGWVHNNKG--EISFAKGMFWGALGGVVGSYCASPFFLIKTQLQAQAAK 139
            .:.:..::..|.:..||..|.:..|  ::||......|.|.|...|...:|..|||.|:|.:..:
  Fly   111 SLFSGIKMLTYDYMREKMIVPDEDGRPQLSFLGSCISGVLAGATASVLTNPTELIKIQMQMEGQR 175

  Fly   140 QIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKS-LLKENGVV 203
            ::. |...:..::..|:..|||..||.|||:|::.|..|:.:.:...::.:...|. |:.|..:|
  Fly   176 RLR-GEPPRIHNVLQALTSIYRTGGVVGLWKGTVPNTWRSALVTIGDVSCYDFCKRFLIAEFDLV 239

  Fly   204 THPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGVYGL 268
            .:..: .|.:.:.||...::...|.|||.:|:.||..|.|||||:|:|.|||:..::|.||...:
  Fly   240 DNREV-QFVAAMTAGVADAILSLPADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAM 303

  Fly   269 YKGFWPIYLRSAPYSTLVLLFFDELIALR 297
            ||||.|.::|..|.|.:..:.|:::...|
  Fly   304 YKGFIPYWMRVGPASVVFWMTFEQIRRFR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 18/74 (24%)
PTZ00169 5..293 CDD:240302 85/283 (30%)
Mito_carr 101..201 CDD:278578 29/102 (28%)
Mito_carr 204..296 CDD:278578 33/91 (36%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 77/261 (30%)
Mito_carr 32..129 CDD:278578 21/82 (26%)
Mito_carr 138..233 CDD:278578 26/95 (27%)
Mito_carr 246..331 CDD:278578 33/84 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.