DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and colt

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:314 Identity:81/314 - (25%)
Similarity:135/314 - (42%) Gaps:53/314 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQ-----GELAARGSHAQP-YKSVFQAFVTVAKNDGILG 64
            |:.||...:...:..:|::.||.|:|..     ||        || |:..|.......||:|:.|
  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGE--------QPLYRGTFDCAAKTIKNEGVRG 75

  Fly    65 LQKGL-------AP--ALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGS 120
            |.||:       ||  |:||.......||.      ::|    ...::::.:....|:..|:..:
  Fly    76 LYKGMSAPLTGVAPIFAMCFAGYALGKRLQ------QRG----EDAKLTYPQIFVAGSFSGLFST 130

  Fly   121 YCASPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAV 185
            ...:|...||..||.|..:    |.:.::..|.|...|:|::.|:..:::||.|.:.|...|:.:
  Fly   131 LIMAPGERIKVLLQTQQGQ----GGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGL 191

  Fly   186 QIAVF----GQAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRG 246
            ...|:    ..|||..:...:.|..||  |..|:|..::..|.: |.||:.:||     .:...|
  Fly   192 YFLVYEALQDVAKSKSETGQISTASTI--FAGGVAGMAYWILGM-PADVLKSRL-----QSAPEG 248

  Fly   247 IYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELIALREKY 300
            .|..|.......::..:|...||:|..||.||:.|.:  ...||.  |.|..|:
  Fly   249 TYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPAN--AACFFG--IELANKF 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 28/95 (29%)
PTZ00169 5..293 CDD:240302 78/305 (26%)
Mito_carr 101..201 CDD:278578 23/103 (22%)
Mito_carr 204..296 CDD:278578 27/91 (30%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 28/101 (28%)
Mito_carr 112..202 CDD:395101 20/93 (22%)
Mito_carr 210..299 CDD:395101 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.