DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Rim2

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:365 Identity:75/365 - (20%)
Similarity:130/365 - (35%) Gaps:94/365 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TSD----FVLGGVAAMGAGVFTNPVEVIKTRIQLQ---------GELAARG-------------- 40
            |:|    .:.||.|.....|.|.|:||:|||:|..         .|.|..|              
  Fly     5 TADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRPEQ 69

  Fly    41 ----------SHAQPY-----------------------KSVFQAFVTVAKNDGILGLQKGLAPA 72
                      :.:||.                       .|:.|....:.:|:|...|.|||.|.
  Fly    70 RRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPN 134

  Fly    73 LCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAK------GMFWGALGGVVGSYCASPFFLIKT 131
            |.  .|..|..:...|::..|    |....:.|.:      .:...|..|.|.|...:|.:.:||
  Fly   135 LV--GVAPSRAIYFCTYSQTK----NTLNSLGFVERDSPLVHIMSAASAGFVSSTATNPIWFVKT 193

  Fly   132 QLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSL 196
            ::|.....::.:       ::...|.::|.:.||...::|..|:.. ....:.|...::...||.
  Fly   194 RMQLDYNSKVQM-------TVRQCIERVYAQGGVAAFYKGITASYF-GICETMVHFVIYEFIKSK 250

  Fly   197 LKENGVVTHP------TILSF-CSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLD 254
            |.|.....|.      ..|.| .:|..:.:..|....|.:|..|||..:|..       |..:..
  Fly   251 LLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLREEGNK-------YNSFWQ 308

  Fly   255 CVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDELI 294
            .:.|:.:.||..|||:|.....:|..|.:.:::..::.::
  Fly   309 TLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYEAVV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 30/142 (21%)
PTZ00169 5..293 CDD:240302 74/360 (21%)
Mito_carr 101..201 CDD:278578 20/105 (19%)
Mito_carr 204..296 CDD:278578 21/98 (21%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 32/153 (21%)
Mito_carr 163..253 CDD:278578 18/97 (19%)
Mito_carr 268..355 CDD:278578 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.