DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:294 Identity:96/294 - (32%)
Similarity:152/294 - (51%) Gaps:12/294 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAAR--GSHAQPYKSVFQAFVTVAKNDGILGLQKG 68
            :::..|||..|.:.|.|:::.|||:|:|||.||.  |.....|:.:......:|:.:|.|.|.:|
  Fly    44 YIVSVVAASIAELATYPLDLTKTRLQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQG 108

  Fly    69 LAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQL 133
            :.|||....|.:..|:..| ..:.|.:..|....:...|....|...|.|..:.|||..|:|.|:
  Fly   109 VTPALYRHVVYSGVRICSY-DLMRKEFTQNGTQALPVWKSALCGVTAGAVAQWLASPADLVKVQI 172

  Fly   134 QAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSL-- 196
            |.:..::: :|...:..|...|.|:|.::.|:.|||:||:.||.||.:.:...:..:...|.|  
  Fly   173 QMEGRRRL-MGEPPRVHSAGHAFRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYDTIKHLIM 236

  Fly   197 --LKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTI 259
              |:.....|...:.|.|:|..|    ::..||.|||.||:.||..|..|||:.|||.:||:...
  Fly   237 NRLQMPDCHTVHVLASVCAGFVA----AIMGTPADVVKTRIMNQPTDENGRGLLYRGSVDCLRQT 297

  Fly   260 LRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFDEL 293
            :..||...|||||.|.::|.||:|....|.|:::
  Fly   298 VSKEGFVALYKGFLPCWIRMAPWSLTFWLSFEQI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 27/82 (33%)
PTZ00169 5..293 CDD:240302 96/292 (33%)
Mito_carr 101..201 CDD:278578 29/103 (28%)
Mito_carr 204..296 CDD:278578 37/90 (41%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 96/294 (33%)
Mito_carr 39..138 CDD:278578 29/94 (31%)
Mito_carr 142..239 CDD:278578 28/97 (29%)
Mito_carr 248..336 CDD:278578 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441277
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.