DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and CG1628

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:323 Identity:81/323 - (25%)
Similarity:125/323 - (38%) Gaps:72/323 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGGVAAMGAGVFTNPVEVIKTRI-----------QLQGELAARGSHAQP--YKSVFQAFVTVAKN 59
            :|...|..:.:...|.|:|:...           :..||....|...:|  .||..:|.     .
  Fly    77 IGSSQAGSSVLIMTPDEIIEAYERALQEGQEEDGETDGEKKKSGWLNRPISVKSTLRAV-----R 136

  Fly    60 DGILGLQKGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGM---FWGALGGVVGSY 121
            ||:|             ||:..|...:....:..|...||   |:|.:|:   ..|:|||....|
  Fly   137 DGLL-------------FVVGGFLRFVRRLDMHGGGTGNN---INFVEGLIDFLAGSLGGAAQVY 185

  Fly   122 CASPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVF-GLWRGSLANVSRATVASAV 185
            .:.|...:|.:||.         :...:..|.|.....|||:||. ||:.||:..|......::|
  Fly   186 VSQPLDTVKVKLQT---------FPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPAVFANVAENSV 241

  Fly   186 QIAVFGQAKSLL-----KEN-GVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLY------NQ 238
            ..|.:|..:..:     ||. |.:|  |:.:.|:|..|..|.:|.:.|.:::..:|.      |.
  Fly   242 LFAAYGGCQKFVAFCVGKETAGDLT--TVQNACAGSLAACFSTLTLCPTELIKCKLQALREMKNF 304

  Fly   239 GVDAQGRGIYYRGWLDCVLT--ILRSEGVYGLYKGFWPIYLRSAP-YSTLVLLFFDELIALRE 298
            ...|..:.| ...|   .||  |.|:||:.|.|:|....:||..| |    ..||......||
  Fly   305 VEPAHPQDI-RTPW---TLTRYIWRTEGIRGFYRGLSSTFLREMPGY----FFFFGSYEGTRE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 18/91 (20%)
PTZ00169 5..293 CDD:240302 79/316 (25%)
Mito_carr 101..201 CDD:278578 29/109 (27%)
Mito_carr 204..296 CDD:278578 28/100 (28%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 62/220 (28%)
Mito_carr 170..252 CDD:278578 24/90 (27%)
Mito_carr 263..364 CDD:278578 31/107 (29%)
Mito_carr 369..455 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.