DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and CG5254

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:312 Identity:75/312 - (24%)
Similarity:122/312 - (39%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATSDFVLGGVAAMGAGVFTNPVEVIKTRIQLQG----ELAARGS-HAQPYKSVFQAFVTVAKNDG 61
            |....:.||.|.........|::|:|||||:|.    ..||.|. |   |..||..|..:.:::|
  Fly    14 AAFQVLAGGSAGFLEVCIMQPLDVVKTRIQIQATPAPNAAALGEVH---YNGVFDCFAKMYRHEG 75

  Fly    62 ILGLQKGLAPALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFW--------------G 112
            |....||:.|.:..:....:.:..::..                .|.:|.              |
  Fly    76 ISSYWKGIMPPILAETPKRAIKFLVFEQ----------------TKPLFQFGSPTPTPLTFSLAG 124

  Fly   113 ALGGVVGSYCASPFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRK-IYRKNGV--FGLWRGSLA 174
            ...|.:.:...:||.::|...||...|::...:         |:.| |.:::|:  .||.:|..|
  Fly   125 LTAGTLEAIAVNPFEVVKVAQQADRQKKMLSTF---------AVAKGIIQQDGLGFSGLNKGITA 180

  Fly   175 NVSRATVASAVQIAVFGQAKSLLKENGVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQG 239
            .:.|..|.:.|....:...|:::.|........:.....|..||:.......|.||..:|:  ||
  Fly   181 TMGRNGVFNMVYFGFYHSVKNVVPEYKESHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRI--QG 243

  Fly   240 VDAQGRGIYYRGWLDCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFD 291
            .......|.|||.|..:..:.|.||...||||..|..:|..|...::||.|:
  Fly   244 PQPVPGQIKYRGTLSSMGIVYREEGFRALYKGLVPKIMRLGPGGAILLLVFE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 24/87 (28%)
PTZ00169 5..293 CDD:240302 74/309 (24%)
Mito_carr 101..201 CDD:278578 23/116 (20%)
Mito_carr 204..296 CDD:278578 27/88 (31%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 26/112 (23%)
PTZ00169 19..301 CDD:240302 74/307 (24%)
Mito_carr 122..207 CDD:278578 21/93 (23%)
Mito_carr 209..305 CDD:278578 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.