DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18327 and Slc25a14

DIOPT Version :9

Sequence 1:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001277634.1 Gene:Slc25a14 / 20523 MGIID:1330823 Length:344 Species:Mus musculus


Alignment Length:292 Identity:95/292 - (32%)
Similarity:156/292 - (53%) Gaps:11/292 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAKNDGILGLQKGLA 70
            ||.||:|::.|...|.||::.|||:|:||:..........|:.:|.|...:.|.:|||.|..|:|
Mouse    63 FVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIA 127

  Fly    71 PALCFQFVINSFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCASPFFLIKTQLQA 135
            |||..|....:.::.|| .::::.:|...:.| :....|..|.:.||:.|..|:|..::|.::||
Mouse   128 PALLRQASYGTIKIGIY-QSLKRLFVERLEDE-TLLINMICGVVSGVISSTIANPTDVLKIRMQA 190

  Fly   136 QAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLLKEN 200
            |.:.     :|   .||..:...||::.|..|||||.:....||.:...|::.|:...|..|..:
Mouse   191 QGSL-----FQ---GSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVS 247

  Fly   201 GVVTHPTILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWLDCVLTILRSEGV 265
            |::....:..|.|....|...:||..|:|||.||:.||.. ..|....|:|.||.:|.:.:.||.
Mouse   248 GMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRA-IVGHVDLYKGTLDGILKMWKHEGF 311

  Fly   266 YGLYKGFWPIYLRSAPYSTLVLLFFDELIALR 297
            :.|||||||.:||..|::.:..:.:::|..|:
Mouse   312 FALYKGFWPNWLRLGPWNIIFFITYEQLKRLQ 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 29/80 (36%)
PTZ00169 5..293 CDD:240302 93/286 (33%)
Mito_carr 101..201 CDD:278578 29/99 (29%)
Mito_carr 204..296 CDD:278578 32/91 (35%)
Slc25a14NP_001277634.1 PTZ00169 63..342 CDD:240302 94/289 (33%)
Mito_carr 253..342 CDD:365909 32/89 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.